Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2421641..2422163 | Replicon | chromosome |
Accession | NZ_CP117244 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQQ30_RS11830 | Protein ID | WP_000221343.1 |
Coordinates | 2421879..2422163 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQQ30_RS11825 | Protein ID | WP_000885424.1 |
Coordinates | 2421641..2421889 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ30_RS11800 (2416857) | 2416857..2418323 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
PQQ30_RS11805 (2419131) | 2419131..2419845 | + | 715 | Protein_2308 | helix-turn-helix domain-containing protein | - |
PQQ30_RS11810 (2419901) | 2419901..2420809 | - | 909 | WP_010989018.1 | hypothetical protein | - |
PQQ30_RS11815 (2420952) | 2420952..2421284 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
PQQ30_RS11820 (2421274) | 2421274..2421489 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PQQ30_RS11825 (2421641) | 2421641..2421889 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQQ30_RS11830 (2421879) | 2421879..2422163 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ30_RS11835 (2422334) | 2422334..2422723 | + | 390 | WP_000194089.1 | RidA family protein | - |
PQQ30_RS11840 (2422775) | 2422775..2423854 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQQ30_RS11845 (2424047) | 2424047..2424535 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQQ30_RS11850 (2424580) | 2424580..2426088 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2416860..2428945 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T270177 WP_000221343.1 NZ_CP117244:2421879-2422163 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |