Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2404727..2404911 | Replicon | chromosome |
Accession | NZ_CP117238 | ||
Organism | Staphylococcus aureus strain ATCC 23235 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | PQQ27_RS12085 | Protein ID | WP_000482652.1 |
Coordinates | 2404804..2404911 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2404727..2404787 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ27_RS12070 (PQQ27_12070) | 2400182..2400313 | - | 132 | WP_223197975.1 | hypothetical protein | - |
PQQ27_RS12075 (PQQ27_12075) | 2400580..2402313 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein | - |
PQQ27_RS12080 (PQQ27_12080) | 2402338..2404101 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein | - |
- | 2404727..2404787 | + | 61 | - | - | Antitoxin |
PQQ27_RS12085 (PQQ27_12085) | 2404804..2404911 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PQQ27_RS12090 (PQQ27_12090) | 2405045..2405431 | - | 387 | WP_000779360.1 | flippase GtxA | - |
PQQ27_RS12095 (PQQ27_12095) | 2405699..2406841 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
PQQ27_RS12100 (PQQ27_12100) | 2406901..2407560 | + | 660 | WP_000831298.1 | membrane protein | - |
PQQ27_RS12105 (PQQ27_12105) | 2407742..2408953 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
PQQ27_RS12110 (PQQ27_12110) | 2409076..2409549 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T270152 WP_000482652.1 NZ_CP117238:c2404911-2404804 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT270152 NZ_CP117238:2404727-2404787 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|