Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1837155..1837335 | Replicon | chromosome |
| Accession | NZ_CP117238 | ||
| Organism | Staphylococcus aureus strain ATCC 23235 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | PQQ27_RS08985 | Protein ID | WP_001801861.1 |
| Coordinates | 1837155..1837250 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1837278..1837335 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ27_RS08955 (PQQ27_08955) | 1832318..1832968 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| PQQ27_RS08960 (PQQ27_08960) | 1833049..1834044 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| PQQ27_RS08965 (PQQ27_08965) | 1834119..1834745 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| PQQ27_RS08970 (PQQ27_08970) | 1834786..1835127 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| PQQ27_RS08975 (PQQ27_08975) | 1835228..1835800 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| PQQ27_RS08980 (PQQ27_08980) | 1835998..1837010 | - | 1013 | Protein_1735 | IS3 family transposase | - |
| PQQ27_RS08985 (PQQ27_08985) | 1837155..1837250 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1837278..1837335 | - | 58 | - | - | Antitoxin |
| PQQ27_RS08990 (PQQ27_08990) | 1837373..1837474 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| PQQ27_RS08995 (PQQ27_08995) | 1837452..1837613 | - | 162 | Protein_1738 | transposase | - |
| PQQ27_RS09000 (PQQ27_09000) | 1837598..1838008 | - | 411 | WP_001808705.1 | IS21 family transposase | - |
| PQQ27_RS09005 (PQQ27_09005) | 1838550..1839779 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| PQQ27_RS09010 (PQQ27_09010) | 1839772..1841328 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| PQQ27_RS09015 (PQQ27_09015) | 1841492..1841626 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1831560..1863290 | 31730 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T270147 WP_001801861.1 NZ_CP117238:1837155-1837250 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT270147 NZ_CP117238:c1837335-1837278 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|