Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4915442..4916044 | Replicon | chromosome |
Accession | NZ_CP117235 | ||
Organism | Escherichia coli strain ATCC 25922 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | PQQ28_RS24090 | Protein ID | WP_000897302.1 |
Coordinates | 4915733..4916044 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PQQ28_RS24085 | Protein ID | WP_000356397.1 |
Coordinates | 4915442..4915732 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ28_RS24060 (4911515) | 4911515..4912417 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PQQ28_RS24065 (4912414) | 4912414..4913049 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PQQ28_RS24070 (4913046) | 4913046..4913975 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
PQQ28_RS24075 (4914191) | 4914191..4914409 | - | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
PQQ28_RS24080 (4914805) | 4914805..4915083 | - | 279 | WP_001296612.1 | hypothetical protein | - |
PQQ28_RS24085 (4915442) | 4915442..4915732 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PQQ28_RS24090 (4915733) | 4915733..4916044 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
PQQ28_RS24095 (4916274) | 4916274..4917182 | + | 909 | WP_001305059.1 | alpha/beta hydrolase | - |
PQQ28_RS24100 (4917246) | 4917246..4918187 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PQQ28_RS24105 (4918232) | 4918232..4918669 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PQQ28_RS24110 (4918666) | 4918666..4919538 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PQQ28_RS24115 (4919532) | 4919532..4920131 | - | 600 | WP_001443191.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T270145 WP_000897302.1 NZ_CP117235:c4916044-4915733 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|