Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4033067..4033865 | Replicon | chromosome |
Accession | NZ_CP117235 | ||
Organism | Escherichia coli strain ATCC 25922 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | Q8VRA6 |
Locus tag | PQQ28_RS19900 | Protein ID | WP_000854730.1 |
Coordinates | 4033488..4033865 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0P0SQV8 |
Locus tag | PQQ28_RS19895 | Protein ID | WP_001285481.1 |
Coordinates | 4033067..4033441 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ28_RS19855 (4029042) | 4029042..4029494 | + | 453 | WP_000682723.1 | hypothetical protein | - |
PQQ28_RS19860 (4029612) | 4029612..4029845 | + | 234 | WP_001213776.1 | DUF905 family protein | - |
PQQ28_RS19865 (4029945) | 4029945..4030766 | + | 822 | WP_001234359.1 | DUF932 domain-containing protein | - |
PQQ28_RS19870 (4030766) | 4030766..4031011 | + | 246 | WP_001164966.1 | hypothetical protein | - |
PQQ28_RS19875 (4031105) | 4031105..4031578 | + | 474 | WP_001313575.1 | antirestriction protein | - |
PQQ28_RS19880 (4031594) | 4031594..4032070 | + | 477 | WP_001313574.1 | RadC family protein | - |
PQQ28_RS19885 (4032133) | 4032133..4032354 | + | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
PQQ28_RS19890 (4032373) | 4032373..4033017 | + | 645 | WP_000086761.1 | hypothetical protein | - |
PQQ28_RS19895 (4033067) | 4033067..4033441 | + | 375 | WP_001285481.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PQQ28_RS19900 (4033488) | 4033488..4033865 | + | 378 | WP_000854730.1 | TA system toxin CbtA family protein | Toxin |
PQQ28_RS19905 (4033862) | 4033862..4034354 | + | 493 | Protein_3831 | DUF5983 family protein | - |
PQQ28_RS19910 (4034433) | 4034433..4035421 | - | 989 | Protein_3832 | IS630 family transposase | - |
PQQ28_RS19915 (4035569) | 4035569..4035757 | - | 189 | Protein_3833 | IS66 family transposase | - |
PQQ28_RS19920 (4035818) | 4035818..4036951 | + | 1134 | WP_000555401.1 | IS110-like element ISEc45 family transposase | - |
PQQ28_RS19925 (4037205) | 4037205..4038609 | - | 1405 | Protein_3835 | IS66 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4033067..4043554 | 10487 | ||
- | inside | Genomic island | - | - | 3986686..4043554 | 56868 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14212.21 Da Isoelectric Point: 7.2923
>T270139 WP_000854730.1 NZ_CP117235:4033488-4033865 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
MKTLPDTHVREASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRMVNDIIRGEHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13817.53 Da Isoelectric Point: 4.7511
>AT270139 WP_001285481.1 NZ_CP117235:4033067-4033441 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTIG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H2V671 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P0SQV8 |