270129

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1931604..1932435 Replicon chromosome
Accession NZ_CP117235
Organism Escherichia coli strain ATCC 25922

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag PQQ28_RS09545 Protein ID WP_000854814.1
Coordinates 1931604..1931978 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1PWQ3
Locus tag PQQ28_RS09550 Protein ID WP_001285586.1
Coordinates 1932067..1932435 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ28_RS09510 (1927008) 1927008..1928228 + 1221 WP_000343765.1 ISL3-like element ISEc53 family transposase -
PQQ28_RS09515 (1928285) 1928285..1928758 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
PQQ28_RS09520 (1928956) 1928956..1930014 + 1059 WP_001200890.1 FUSC family protein -
PQQ28_RS09525 (1930186) 1930186..1930515 + 330 WP_000450409.1 DUF496 family protein -
PQQ28_RS09530 (1930616) 1930616..1930972 - 357 WP_000929389.1 EutP/PduV family microcompartment system protein -
PQQ28_RS09535 (1931287) 1931287..1931367 - 81 Protein_1792 hypothetical protein -
PQQ28_RS09540 (1931413) 1931413..1931607 - 195 WP_000988601.1 DUF5983 family protein -
PQQ28_RS09545 (1931604) 1931604..1931978 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PQQ28_RS09550 (1932067) 1932067..1932435 - 369 WP_001285586.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PQQ28_RS09555 (1932509) 1932509..1932730 - 222 WP_000692323.1 DUF987 domain-containing protein -
PQQ28_RS09560 (1932799) 1932799..1933275 - 477 WP_001351157.1 RadC family protein -
PQQ28_RS09565 (1933291) 1933291..1933776 - 486 WP_000213703.1 antirestriction protein -
PQQ28_RS09570 (1933867) 1933867..1934688 - 822 WP_001234569.1 DUF932 domain-containing protein -
PQQ28_RS09575 (1934909) 1934909..1935319 - 411 WP_000846704.1 hypothetical protein -
PQQ28_RS09580 (1935335) 1935335..1936012 - 678 WP_001362823.1 hypothetical protein -
PQQ28_RS09585 (1936148) 1936148..1937218 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
flank IS/Tn - - 1927008..1928228 1220


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T270129 WP_000854814.1 NZ_CP117235:c1931978-1931604 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13563.41 Da        Isoelectric Point: 5.0468

>AT270129 WP_001285586.1 NZ_CP117235:c1932435-1932067 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB S1PWQ3

References