Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 621470..622269 | Replicon | chromosome |
Accession | NZ_CP117235 | ||
Organism | Escherichia coli strain ATCC 25922 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | Q8FDB4 |
Locus tag | PQQ28_RS03435 | Protein ID | WP_000347252.1 |
Coordinates | 621470..621934 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | PQQ28_RS03440 | Protein ID | WP_001296435.1 |
Coordinates | 621934..622269 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ28_RS03405 (616471) | 616471..616905 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PQQ28_RS03410 (616923) | 616923..617801 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PQQ28_RS03415 (617791) | 617791..618570 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PQQ28_RS03420 (618581) | 618581..619054 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PQQ28_RS03425 (619077) | 619077..620357 | - | 1281 | WP_000681926.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PQQ28_RS03430 (620606) | 620606..621415 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
PQQ28_RS03435 (621470) | 621470..621934 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PQQ28_RS03440 (621934) | 621934..622269 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PQQ28_RS03445 (622418) | 622418..623989 | - | 1572 | WP_001273940.1 | galactarate dehydratase | - |
PQQ28_RS03450 (624364) | 624364..625698 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
PQQ28_RS03455 (625714) | 625714..626484 | + | 771 | WP_001058223.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T270124 WP_000347252.1 NZ_CP117235:c621934-621470 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|