Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2300..2946 | Replicon | plasmid pATCC25922_4 |
Accession | NZ_CP117232 | ||
Organism | Escherichia coli strain ATCC 25922 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7R6ZH56 |
Locus tag | PQQ28_RS00020 | Protein ID | WP_000269913.1 |
Coordinates | 2300..2647 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1V3UZT0 |
Locus tag | PQQ28_RS00025 | Protein ID | WP_001259436.1 |
Coordinates | 2647..2946 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ28_RS00010 (PQQ28_00010) | 1481..1768 | + | 288 | WP_000356589.1 | hypothetical protein | - |
PQQ28_RS00015 (PQQ28_00015) | 1792..2055 | + | 264 | WP_000424604.1 | hypothetical protein | - |
PQQ28_RS00020 (PQQ28_00020) | 2300..2647 | + | 348 | WP_000269913.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ28_RS00025 (PQQ28_00025) | 2647..2946 | + | 300 | WP_001259436.1 | XRE family transcriptional regulator | Antitoxin |
PQQ28_RS00030 (PQQ28_00030) | 3110..3490 | + | 381 | WP_000061764.1 | hypothetical protein | - |
PQQ28_RS00035 (PQQ28_00035) | 3554..3826 | + | 273 | WP_000148349.1 | helix-turn-helix domain-containing protein | - |
PQQ28_RS00040 (PQQ28_00040) | 4437..4625 | + | 189 | WP_000986262.1 | hypothetical protein | - |
PQQ28_RS00045 (PQQ28_00045) | 4636..5778 | - | 1143 | WP_000854799.1 | ORF6N domain-containing protein | - |
PQQ28_RS00050 (PQQ28_00050) | 5775..5966 | - | 192 | WP_000183352.1 | hypothetical protein | - |
PQQ28_RS00055 (PQQ28_00055) | 6540..7112 | + | 573 | WP_000137931.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..48488 | 48488 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13486.53 Da Isoelectric Point: 9.8723
>T270123 WP_000269913.1 NZ_CP117232:2300-2647 [Escherichia coli]
MWTVLFSQRFDGWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK
MWTVLFSQRFDGWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYKKLVRIAEDEFAAHLNTLESK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7R6ZH56 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3UZT0 |