Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2460752..2460936 | Replicon | chromosome |
Accession | NZ_CP117230 | ||
Organism | Staphylococcus aureus strain ATCC 25923 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | PQQ26_RS12290 | Protein ID | WP_000482647.1 |
Coordinates | 2460829..2460936 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2460752..2460812 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ26_RS12275 (PQQ26_12275) | 2456262..2456429 | - | 168 | Protein_2376 | hypothetical protein | - |
PQQ26_RS12280 (PQQ26_12280) | 2456660..2458393 | - | 1734 | WP_000486507.1 | ABC transporter ATP-binding protein | - |
PQQ26_RS12285 (PQQ26_12285) | 2458418..2460181 | - | 1764 | WP_001064828.1 | ATP-binding cassette domain-containing protein | - |
- | 2460752..2460812 | + | 61 | - | - | Antitoxin |
PQQ26_RS12290 (PQQ26_12290) | 2460829..2460936 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
PQQ26_RS12295 (PQQ26_12295) | 2461070..2461456 | - | 387 | WP_000779351.1 | flippase GtxA | - |
PQQ26_RS12300 (PQQ26_12300) | 2461724..2462866 | + | 1143 | WP_001176855.1 | glycerate kinase | - |
PQQ26_RS12305 (PQQ26_12305) | 2462926..2463585 | + | 660 | WP_000831298.1 | membrane protein | - |
PQQ26_RS12310 (PQQ26_12310) | 2463767..2464978 | + | 1212 | WP_001191919.1 | multidrug effflux MFS transporter | - |
PQQ26_RS12315 (PQQ26_12315) | 2465101..2465574 | - | 474 | WP_000456499.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T270121 WP_000482647.1 NZ_CP117230:c2460936-2460829 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT270121 NZ_CP117230:2460752-2460812 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|