Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
| Location | 2175657..2175854 | Replicon | chromosome |
| Accession | NZ_CP117230 | ||
| Organism | Staphylococcus aureus strain ATCC 25923 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | - |
| Locus tag | PQQ26_RS10795 | Protein ID | WP_073392962.1 |
| Coordinates | 2175750..2175854 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2175657..2175695 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ26_RS10770 (PQQ26_10770) | 2171832..2172497 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
| PQQ26_RS10775 (PQQ26_10775) | 2172649..2172969 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| PQQ26_RS10780 (PQQ26_10780) | 2172971..2173951 | + | 981 | WP_000019741.1 | CDF family zinc efflux transporter CzrB | - |
| PQQ26_RS10785 (PQQ26_10785) | 2174217..2175308 | + | 1092 | WP_000495684.1 | hypothetical protein | - |
| PQQ26_RS10790 (PQQ26_10790) | 2175637..2175711 | + | 75 | Protein_2088 | hypothetical protein | - |
| - | 2175657..2175695 | + | 39 | - | - | Antitoxin |
| PQQ26_RS10795 (PQQ26_10795) | 2175750..2175854 | - | 105 | WP_073392962.1 | hypothetical protein | Toxin |
| PQQ26_RS10800 (PQQ26_10800) | 2176534..2176692 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| PQQ26_RS10805 (PQQ26_10805) | 2177351..2178208 | - | 858 | WP_000370937.1 | HAD family hydrolase | - |
| PQQ26_RS10810 (PQQ26_10810) | 2178276..2179058 | - | 783 | WP_000908186.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3920.80 Da Isoelectric Point: 5.5724
>T270119 WP_073392962.1 NZ_CP117230:c2175854-2175750 [Staphylococcus aureus]
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMIVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 39 bp
>AT270119 NZ_CP117230:2175657-2175695 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|