Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1875017..1875197 Replicon chromosome
Accession NZ_CP117230
Organism Staphylococcus aureus strain ATCC 25923

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag PQQ26_RS09075 Protein ID WP_001801861.1
Coordinates 1875017..1875112 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1875140..1875197 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ26_RS09045 (PQQ26_09045) 1870161..1870787 + 627 WP_000669038.1 hypothetical protein -
PQQ26_RS09050 (PQQ26_09050) 1870828..1871172 + 345 WP_000627550.1 DUF3969 family protein -
PQQ26_RS09055 (PQQ26_09055) 1871270..1871842 + 573 Protein_1784 hypothetical protein -
PQQ26_RS09060 (PQQ26_09060) 1871991..1873358 - 1368 WP_001093574.1 FRG domain-containing protein -
PQQ26_RS09065 (PQQ26_09065) 1873358..1873927 - 570 WP_000125075.1 ImmA/IrrE family metallo-endopeptidase -
PQQ26_RS09070 (PQQ26_09070) 1874120..1874566 - 447 WP_000747804.1 DUF1433 domain-containing protein -
PQQ26_RS09075 (PQQ26_09075) 1875017..1875112 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1875140..1875197 - 58 - - Antitoxin
PQQ26_RS09080 (PQQ26_09080) 1875235..1875336 + 102 WP_001791232.1 hypothetical protein -
PQQ26_RS09085 (PQQ26_09085) 1875511..1875954 - 444 WP_001037039.1 DUF1433 domain-containing protein -
PQQ26_RS09090 (PQQ26_09090) 1875954..1876397 - 444 WP_000731421.1 DUF1433 domain-containing protein -
PQQ26_RS09095 (PQQ26_09095) 1876397..1876839 - 443 Protein_1792 DUF1433 domain-containing protein -
PQQ26_RS09100 (PQQ26_09100) 1877364..1879773 + 2410 Protein_1793 polysaccharide lyase 8 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T270114 WP_001801861.1 NZ_CP117230:1875017-1875112 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 58 bp

>AT270114 NZ_CP117230:c1875197-1875140 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References