Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1875017..1875197 | Replicon | chromosome |
| Accession | NZ_CP117230 | ||
| Organism | Staphylococcus aureus strain ATCC 25923 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | PQQ26_RS09075 | Protein ID | WP_001801861.1 |
| Coordinates | 1875017..1875112 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1875140..1875197 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ26_RS09045 (PQQ26_09045) | 1870161..1870787 | + | 627 | WP_000669038.1 | hypothetical protein | - |
| PQQ26_RS09050 (PQQ26_09050) | 1870828..1871172 | + | 345 | WP_000627550.1 | DUF3969 family protein | - |
| PQQ26_RS09055 (PQQ26_09055) | 1871270..1871842 | + | 573 | Protein_1784 | hypothetical protein | - |
| PQQ26_RS09060 (PQQ26_09060) | 1871991..1873358 | - | 1368 | WP_001093574.1 | FRG domain-containing protein | - |
| PQQ26_RS09065 (PQQ26_09065) | 1873358..1873927 | - | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| PQQ26_RS09070 (PQQ26_09070) | 1874120..1874566 | - | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| PQQ26_RS09075 (PQQ26_09075) | 1875017..1875112 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1875140..1875197 | - | 58 | - | - | Antitoxin |
| PQQ26_RS09080 (PQQ26_09080) | 1875235..1875336 | + | 102 | WP_001791232.1 | hypothetical protein | - |
| PQQ26_RS09085 (PQQ26_09085) | 1875511..1875954 | - | 444 | WP_001037039.1 | DUF1433 domain-containing protein | - |
| PQQ26_RS09090 (PQQ26_09090) | 1875954..1876397 | - | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| PQQ26_RS09095 (PQQ26_09095) | 1876397..1876839 | - | 443 | Protein_1792 | DUF1433 domain-containing protein | - |
| PQQ26_RS09100 (PQQ26_09100) | 1877364..1879773 | + | 2410 | Protein_1793 | polysaccharide lyase 8 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T270114 WP_001801861.1 NZ_CP117230:1875017-1875112 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 58 bp
>AT270114 NZ_CP117230:c1875197-1875140 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
