Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 350588..351234 | Replicon | chromosome |
| Accession | NZ_CP117227 | ||
| Organism | Klebsiella pneumoniae strain ATCC BAA2146 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | W8UNE1 |
| Locus tag | PQQ24_RS03530 | Protein ID | WP_002920560.1 |
| Coordinates | 350588..350935 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | PQQ24_RS03535 | Protein ID | WP_002920557.1 |
| Coordinates | 350935..351234 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ24_RS03520 (PQQ24_03520) | 346514..347947 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| PQQ24_RS03525 (PQQ24_03525) | 347965..350412 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| PQQ24_RS03530 (PQQ24_03530) | 350588..350935 | + | 348 | WP_002920560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ24_RS03535 (PQQ24_03535) | 350935..351234 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PQQ24_RS03540 (PQQ24_03540) | 351297..352805 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| PQQ24_RS03545 (PQQ24_03545) | 353010..353339 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| PQQ24_RS03550 (PQQ24_03550) | 353390..354220 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| PQQ24_RS03555 (PQQ24_03555) | 354270..355028 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13502.56 Da Isoelectric Point: 6.2300
>T270097 WP_002920560.1 NZ_CP117227:350588-350935 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBY5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBF8 |