Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 13599..14256 | Replicon | plasmid pATCCBAA2146_4 |
| Accession | NZ_CP117223 | ||
| Organism | Klebsiella pneumoniae strain ATCC BAA2146 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U3PDC3 |
| Locus tag | PQQ24_RS00120 | Protein ID | WP_000270043.1 |
| Coordinates | 13906..14256 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQQ24_RS00115 | Protein ID | WP_000124640.1 |
| Coordinates | 13599..13901 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ24_RS00065 (PQQ24_00065) | 9233..9661 | + | 429 | WP_000591076.1 | hypothetical protein | - |
| PQQ24_RS00070 (PQQ24_00070) | 9719..10078 | + | 360 | WP_000422769.1 | hypothetical protein | - |
| PQQ24_RS00075 (PQQ24_00075) | 10078..10524 | + | 447 | WP_000919343.1 | hypothetical protein | - |
| PQQ24_RS00080 (PQQ24_00080) | 10521..11039 | + | 519 | WP_000210757.1 | nitrite reductase | - |
| PQQ24_RS00085 (PQQ24_00085) | 11039..11269 | + | 231 | WP_000972665.1 | hypothetical protein | - |
| PQQ24_RS00090 (PQQ24_00090) | 11256..12113 | + | 858 | WP_001167036.1 | hypothetical protein | - |
| PQQ24_RS00095 (PQQ24_00095) | 12139..12330 | + | 192 | WP_001270409.1 | hypothetical protein | - |
| PQQ24_RS00100 (PQQ24_00100) | 12333..12860 | + | 528 | WP_004201083.1 | thermonuclease family protein | - |
| PQQ24_RS00105 (PQQ24_00105) | 12918..13190 | + | 273 | WP_001043046.1 | HU family DNA-binding protein | - |
| PQQ24_RS00110 (PQQ24_00110) | 13279..13572 | + | 294 | WP_001239998.1 | hypothetical protein | - |
| PQQ24_RS00115 (PQQ24_00115) | 13599..13901 | - | 303 | WP_000124640.1 | XRE family transcriptional regulator | Antitoxin |
| PQQ24_RS00120 (PQQ24_00120) | 13906..14256 | - | 351 | WP_000270043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ24_RS00125 (PQQ24_00125) | 14419..14967 | + | 549 | WP_001061573.1 | hypothetical protein | - |
| PQQ24_RS00130 (PQQ24_00130) | 15308..15502 | + | 195 | WP_000343597.1 | hypothetical protein | - |
| PQQ24_RS00135 (PQQ24_00135) | 15513..15884 | + | 372 | WP_000516918.1 | hypothetical protein | - |
| PQQ24_RS00140 (PQQ24_00140) | 15877..16347 | + | 471 | WP_001281821.1 | hypothetical protein | - |
| PQQ24_RS00145 (PQQ24_00145) | 16362..16697 | - | 336 | WP_000683477.1 | hypothetical protein | - |
| PQQ24_RS00150 (PQQ24_00150) | 16794..17282 | + | 489 | WP_001273096.1 | DUF1643 domain-containing protein | - |
| PQQ24_RS00155 (PQQ24_00155) | 17285..17782 | + | 498 | WP_000062185.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-6 / aac(6')-Ib / qacE / sul1 / rmtC / blaNDM-1 | htpB | 1..140825 | 140825 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13328.21 Da Isoelectric Point: 5.2421
>T270093 WP_000270043.1 NZ_CP117223:c14256-13906 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|