Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2170812..2171029 | Replicon | chromosome |
| Accession | NZ_CP117203 | ||
| Organism | Staphylococcus aureus strain 2022QW-00133 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | PQQ74_RS10770 | Protein ID | WP_001802298.1 |
| Coordinates | 2170925..2171029 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2170812..2170867 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ74_RS10745 | 2166949..2167614 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| PQQ74_RS10750 | 2167766..2168086 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| PQQ74_RS10755 | 2168088..2169068 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| PQQ74_RS10760 | 2169334..2170425 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2170812..2170867 | + | 56 | - | - | Antitoxin |
| PQQ74_RS10770 | 2170925..2171029 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| PQQ74_RS10775 | 2171190..2171673 | - | 484 | Protein_2081 | recombinase family protein | - |
| PQQ74_RS10780 | 2171716..2172852 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| PQQ74_RS10785 | 2173141..2173233 | + | 93 | WP_001790138.1 | hypothetical protein | - |
| PQQ74_RS10790 | 2173938..2174795 | - | 858 | WP_000370924.1 | HAD family hydrolase | - |
| PQQ74_RS10795 | 2174863..2175645 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T270089 WP_001802298.1 NZ_CP117203:c2171029-2170925 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT270089 NZ_CP117203:2170812-2170867 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|