Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1996143..1996442 | Replicon | chromosome |
| Accession | NZ_CP117203 | ||
| Organism | Staphylococcus aureus strain 2022QW-00133 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | PQQ74_RS09775 | Protein ID | WP_011447039.1 |
| Coordinates | 1996266..1996442 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1996143..1996198 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ74_RS09735 | 1991474..1991734 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| PQQ74_RS09740 | 1991787..1992137 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| PQQ74_RS09745 | 1992822..1993271 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| PQQ74_RS09750 | 1993366..1993701 | - | 336 | Protein_1881 | SH3 domain-containing protein | - |
| PQQ74_RS09755 | 1994351..1994842 | - | 492 | WP_000919350.1 | staphylokinase | - |
| PQQ74_RS09760 | 1995033..1995788 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| PQQ74_RS09765 | 1995800..1996054 | - | 255 | WP_000611512.1 | phage holin | - |
| PQQ74_RS09770 | 1996106..1996213 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 1996135..1996274 | + | 140 | NuclAT_0 | - | - |
| - | 1996135..1996274 | + | 140 | NuclAT_0 | - | - |
| - | 1996135..1996274 | + | 140 | NuclAT_0 | - | - |
| - | 1996135..1996274 | + | 140 | NuclAT_0 | - | - |
| - | 1996143..1996198 | + | 56 | - | - | Antitoxin |
| PQQ74_RS09775 | 1996266..1996442 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| PQQ74_RS09780 | 1996592..1996888 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| PQQ74_RS09785 | 1996946..1997233 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| PQQ74_RS09790 | 1997280..1997432 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| PQQ74_RS09795 | 1997422..2001207 | - | 3786 | WP_273655515.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1991787..2047736 | 55949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T270084 WP_011447039.1 NZ_CP117203:c1996442-1996266 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 56 bp
>AT270084 NZ_CP117203:1996143-1996198 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|