Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1835153..1835335 Replicon chromosome
Accession NZ_CP117203
Organism Staphylococcus aureus strain 2022QW-00133

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag PQQ74_RS08785 Protein ID WP_001801861.1
Coordinates 1835153..1835248 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1835276..1835335 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ74_RS08745 1830813..1831439 + 627 Protein_1719 hypothetical protein -
PQQ74_RS08750 1831480..1831824 + 345 WP_000627551.1 DUF3969 family protein -
PQQ74_RS08755 1831922..1832473 + 552 WP_000414205.1 hypothetical protein -
PQQ74_RS08760 1832691..1833332 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
PQQ74_RS08765 1833446..1833631 - 186 WP_000809857.1 hypothetical protein -
PQQ74_RS08770 1833633..1833809 - 177 WP_000375476.1 hypothetical protein -
PQQ74_RS08775 1833820..1834203 - 384 WP_000070811.1 hypothetical protein -
PQQ74_RS08780 1834807..1834950 - 144 WP_001549059.1 transposase -
PQQ74_RS08785 1835153..1835248 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1835276..1835335 - 60 - - Antitoxin
PQQ74_RS08790 1835371..1835472 + 102 WP_001791893.1 hypothetical protein -
PQQ74_RS08795 1835450..1835626 - 177 Protein_1729 transposase -
PQQ74_RS08800 1835820..1836197 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - lukD / hlgA 1804788..1889785 84997


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T270082 WP_001801861.1 NZ_CP117203:1835153-1835248 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT270082 NZ_CP117203:c1835335-1835276 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References