Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
Location | 407127..407778 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117200 | ||
Organism | Pantoea sp. SS70 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PO881_RS21515 | Protein ID | WP_137387145.1 |
Coordinates | 407127..407471 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PO881_RS21520 | Protein ID | WP_280172933.1 |
Coordinates | 407464..407778 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO881_RS21495 (PO881_21495) | 402247..402945 | + | 699 | WP_280172931.1 | methionine ABC transporter permease | - |
PO881_RS21500 (PO881_21500) | 402942..403817 | + | 876 | WP_192414680.1 | MetQ/NlpA family ABC transporter substrate-binding protein | - |
PO881_RS21505 (PO881_21505) | 403995..405434 | + | 1440 | WP_110867055.1 | MFS transporter | - |
PO881_RS21510 (PO881_21510) | 405431..406645 | + | 1215 | WP_280172932.1 | monooxygenase | - |
PO881_RS21515 (PO881_21515) | 407127..407471 | + | 345 | WP_137387145.1 | toxin | Toxin |
PO881_RS21520 (PO881_21520) | 407464..407778 | + | 315 | WP_280172933.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
PO881_RS21525 (PO881_21525) | 407913..408860 | - | 948 | WP_280172934.1 | sulfonate ABC transporter substrate-binding protein | - |
PO881_RS21530 (PO881_21530) | 409115..411172 | + | 2058 | WP_280172935.1 | FUSC family protein | - |
PO881_RS21535 (PO881_21535) | 411188..411877 | + | 690 | WP_222212286.1 | aspartate/glutamate racemase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..779368 | 779368 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13492.32 Da Isoelectric Point: 9.9070
>T270078 WP_137387145.1 NZ_CP117200:407127-407471 [Pantoea sp. SS70]
MHATFIELSSFQKYRVEYLSDDQFRLFQNMLMADPEKGDVIPDTGGLRKVRFRDERRNKGTRGGIRVIYYWTNEKGQFIL
FTIYDKDQRDDLTKQQRDALGSALNVIKKGLRHD
MHATFIELSSFQKYRVEYLSDDQFRLFQNMLMADPEKGDVIPDTGGLRKVRFRDERRNKGTRGGIRVIYYWTNEKGQFIL
FTIYDKDQRDDLTKQQRDALGSALNVIKKGLRHD
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|