Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 164172..165010 | Replicon | plasmid unnamed1 |
Accession | NZ_CP117200 | ||
Organism | Pantoea sp. SS70 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | PO881_RS20365 | Protein ID | WP_277975061.1 |
Coordinates | 164172..164654 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | - |
Locus tag | PO881_RS20370 | Protein ID | WP_277976470.1 |
Coordinates | 164672..165010 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PO881_RS20345 (PO881_20345) | 159459..160421 | + | 963 | WP_280173324.1 | ABC transporter substrate-binding protein | - |
PO881_RS20350 (PO881_20350) | 160429..161844 | + | 1416 | WP_280173194.1 | amidohydrolase family protein | - |
PO881_RS20355 (PO881_20355) | 161850..163370 | - | 1521 | WP_277975059.1 | MDR family MFS transporter | - |
PO881_RS20360 (PO881_20360) | 163450..164115 | + | 666 | WP_277975060.1 | TetR/AcrR family transcriptional regulator | - |
PO881_RS20365 (PO881_20365) | 164172..164654 | - | 483 | WP_277975061.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
PO881_RS20370 (PO881_20370) | 164672..165010 | - | 339 | WP_277976470.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
PO881_RS20375 (PO881_20375) | 165226..165792 | + | 567 | WP_110866778.1 | peroxiredoxin | - |
PO881_RS20380 (PO881_20380) | 165808..167037 | + | 1230 | WP_280173196.1 | thioredoxin family protein | - |
PO881_RS20385 (PO881_20385) | 167055..167612 | + | 558 | WP_192234665.1 | sigma-70 family RNA polymerase sigma factor | - |
PO881_RS20390 (PO881_20390) | 167599..168228 | + | 630 | WP_280173197.1 | NrsF family protein | - |
PO881_RS20395 (PO881_20395) | 168389..168658 | + | 270 | WP_101761698.1 | DUF1471 family periplasmic protein YahO | - |
PO881_RS20400 (PO881_20400) | 168826..169893 | - | 1068 | WP_280173198.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..779368 | 779368 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 18802.44 Da Isoelectric Point: 9.2890
>T270074 WP_277975061.1 NZ_CP117200:c164654-164172 [Pantoea sp. SS70]
VDYMEINGWKFYFHACFSAQVTSLAQEVLQLRVEKPHEYHKKKQTKLLAAIYKVVTEVIARDPLNPQFRQGGTLGDENRY
WFRAKFLQQFRLFFRCSEQSKTIILGWVNDFGTLRAYESKTDAYKTFKRMLDAGHPPSDWEQLLRESTGESGFLFQAPFS
VDYMEINGWKFYFHACFSAQVTSLAQEVLQLRVEKPHEYHKKKQTKLLAAIYKVVTEVIARDPLNPQFRQGGTLGDENRY
WFRAKFLQQFRLFFRCSEQSKTIILGWVNDFGTLRAYESKTDAYKTFKRMLDAGHPPSDWEQLLRESTGESGFLFQAPFS
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|