Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3945576..3946260 | Replicon | chromosome |
| Accession | NZ_CP117199 | ||
| Organism | Pantoea sp. SS70 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PO881_RS18255 | Protein ID | WP_101762747.1 |
| Coordinates | 3945952..3946260 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PO881_RS18250 | Protein ID | WP_101762746.1 |
| Coordinates | 3945576..3945908 (-) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO881_RS18235 (PO881_18235) | 3942378..3944057 | - | 1680 | WP_280172180.1 | potassium-transporting ATPase subunit KdpA | - |
| PO881_RS18240 (PO881_18240) | 3944057..3944146 | - | 90 | WP_081113208.1 | K(+)-transporting ATPase subunit F | - |
| PO881_RS18245 (PO881_18245) | 3944256..3945419 | - | 1164 | WP_280172181.1 | HD-GYP domain-containing protein | - |
| PO881_RS18250 (PO881_18250) | 3945576..3945908 | - | 333 | WP_101762746.1 | HigA family addiction module antitoxin | Antitoxin |
| PO881_RS18255 (PO881_18255) | 3945952..3946260 | - | 309 | WP_101762747.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PO881_RS18260 (PO881_18260) | 3946384..3947775 | - | 1392 | WP_280172182.1 | MFS transporter | - |
| PO881_RS18265 (PO881_18265) | 3948187..3949101 | + | 915 | WP_192415485.1 | sugar ABC transporter substrate-binding protein | - |
| PO881_RS18270 (PO881_18270) | 3949184..3949678 | - | 495 | WP_280172183.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 12123.94 Da Isoelectric Point: 10.3572
>T270072 WP_101762747.1 NZ_CP117199:c3946260-3945952 [Pantoea sp. SS70]
MKGSIHSFRDDWLRLFFVYATPHKHIPAMIESALARKLDIIHAATSHHDLRSPPGNRFEALRPPLLGYYSIRINEQYRLI
FQWVNGTARDLYLDPHTYRKHR
MKGSIHSFRDDWLRLFFVYATPHKHIPAMIESALARKLDIIHAATSHHDLRSPPGNRFEALRPPLLGYYSIRINEQYRLI
FQWVNGTARDLYLDPHTYRKHR
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|