Detailed information of TA system TA270059

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 24465..24734
• Replicon: plasmid p123_CTX-M
• Accession: NZ_CP117185
• Organism: Salmonella enterica subsp. enterica strain 123

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PQ453_RS24980
• Protein ID: WP_001372321.1
• Coordinates: 24609..24734 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	24465..24530 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PQ453_RS24950	20175..20702	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
PQ453_RS24955	20760..20993	+	234	WP_000006003.1	DUF905 family protein	-
PQ453_RS24960	21054..23077	+	2024	Protein_30	ParB/RepB/Spo0J family partition protein	-
PQ453_RS24965	23146..23580	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PQ453_RS24970	23577..24296	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	24308..24532	+	225	NuclAT_0	-	-
-	24308..24532	+	225	NuclAT_0	-	-
-	24308..24532	+	225	NuclAT_0	-	-
-	24308..24532	+	225	NuclAT_0	-	-
-	24465..24530	-	66	-	-	Antitoxin
PQ453_RS24975	24518..24667	+	150	Protein_33	plasmid maintenance protein Mok	-
PQ453_RS24980	24609..24734	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PQ453_RS24985	25053..25349	-	297	Protein_35	hypothetical protein	-
PQ453_RS24990	25649..25945	+	297	WP_001272251.1	hypothetical protein	-
PQ453_RS24995	26056..26877	+	822	WP_001234445.1	DUF932 domain-containing protein	-
PQ453_RS25000	27174..27764	-	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
PQ453_RS25005	28099..28482	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PQ453_RS25010	28676..29347	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
PQ453_RS25015	29484..29711	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T270059 WP_001372321.1 NZ_CP117185:24609-24734 [Salmonella enterica subsp. enterica]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT270059 NZ_CP117185:c24530-24465 [Salmonella enterica subsp. enterica]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin