Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 24465..24734 | Replicon | plasmid p123_CTX-M |
| Accession | NZ_CP117185 | ||
| Organism | Salmonella enterica subsp. enterica strain 123 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PQ453_RS24980 | Protein ID | WP_001372321.1 |
| Coordinates | 24609..24734 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 24465..24530 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ453_RS24950 | 20175..20702 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| PQ453_RS24955 | 20760..20993 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| PQ453_RS24960 | 21054..23077 | + | 2024 | Protein_30 | ParB/RepB/Spo0J family partition protein | - |
| PQ453_RS24965 | 23146..23580 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| PQ453_RS24970 | 23577..24296 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 24308..24532 | + | 225 | NuclAT_0 | - | - |
| - | 24308..24532 | + | 225 | NuclAT_0 | - | - |
| - | 24308..24532 | + | 225 | NuclAT_0 | - | - |
| - | 24308..24532 | + | 225 | NuclAT_0 | - | - |
| - | 24465..24530 | - | 66 | - | - | Antitoxin |
| PQ453_RS24975 | 24518..24667 | + | 150 | Protein_33 | plasmid maintenance protein Mok | - |
| PQ453_RS24980 | 24609..24734 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PQ453_RS24985 | 25053..25349 | - | 297 | Protein_35 | hypothetical protein | - |
| PQ453_RS24990 | 25649..25945 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| PQ453_RS24995 | 26056..26877 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| PQ453_RS25000 | 27174..27764 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
| PQ453_RS25005 | 28099..28482 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PQ453_RS25010 | 28676..29347 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| PQ453_RS25015 | 29484..29711 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T270059 WP_001372321.1 NZ_CP117185:24609-24734 [Salmonella enterica subsp. enterica]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT270059 NZ_CP117185:c24530-24465 [Salmonella enterica subsp. enterica]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|