Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 24308..24734 | Replicon | plasmid p123_CTX-M |
Accession | NZ_CP117185 | ||
Organism | Salmonella enterica subsp. enterica strain 123 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | PQ453_RS24980 | Protein ID | WP_001372321.1 |
Coordinates | 24609..24734 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 24308..24532 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ453_RS24945 (19406) | 19406..19873 | - | 468 | Protein_27 | hypothetical protein | - |
PQ453_RS24950 (20175) | 20175..20702 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
PQ453_RS24955 (20760) | 20760..20993 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
PQ453_RS24960 (21054) | 21054..23077 | + | 2024 | Protein_30 | ParB/RepB/Spo0J family partition protein | - |
PQ453_RS24965 (23146) | 23146..23580 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
PQ453_RS24970 (23577) | 23577..24296 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- (24308) | 24308..24532 | + | 225 | NuclAT_0 | - | Antitoxin |
- (24308) | 24308..24532 | + | 225 | NuclAT_0 | - | Antitoxin |
- (24308) | 24308..24532 | + | 225 | NuclAT_0 | - | Antitoxin |
- (24308) | 24308..24532 | + | 225 | NuclAT_0 | - | Antitoxin |
PQ453_RS24975 (24518) | 24518..24667 | + | 150 | Protein_33 | plasmid maintenance protein Mok | - |
PQ453_RS24980 (24609) | 24609..24734 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
PQ453_RS24985 (25053) | 25053..25349 | - | 297 | Protein_35 | hypothetical protein | - |
PQ453_RS24990 (25649) | 25649..25945 | + | 297 | WP_001272251.1 | hypothetical protein | - |
PQ453_RS24995 (26056) | 26056..26877 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
PQ453_RS25000 (27174) | 27174..27764 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
PQ453_RS25005 (28099) | 28099..28482 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
PQ453_RS25010 (28676) | 28676..29347 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
PQ453_RS25015 (29484) | 29484..29711 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T270058 WP_001372321.1 NZ_CP117185:24609-24734 [Salmonella enterica subsp. enterica]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT270058 NZ_CP117185:24308-24532 [Salmonella enterica subsp. enterica]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|