Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4986766..4987520 | Replicon | chromosome |
| Accession | NZ_CP117184 | ||
| Organism | Salmonella enterica subsp. enterica strain 123 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQ453_RS24615 | Protein ID | WP_000558166.1 |
| Coordinates | 4987209..4987520 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQ453_RS24610 | Protein ID | WP_001259011.1 |
| Coordinates | 4986766..4987212 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ453_RS24580 (4981942) | 4981942..4982838 | + | 897 | WP_001520529.1 | sugar kinase | - |
| PQ453_RS24585 (4982872) | 4982872..4983675 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQ453_RS24590 (4983866) | 4983866..4984465 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PQ453_RS24595 (4984459) | 4984459..4985331 | + | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| PQ453_RS24600 (4985328) | 4985328..4985765 | + | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| PQ453_RS24605 (4985810) | 4985810..4986751 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQ453_RS24610 (4986766) | 4986766..4987212 | - | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQ453_RS24615 (4987209) | 4987209..4987520 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQ453_RS24620 (4987606) | 4987606..4988535 | - | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| PQ453_RS24625 (4988753) | 4988753..4989064 | + | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PQ453_RS24630 (4989065) | 4989065..4989355 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQ453_RS24635 (4989402) | 4989402..4990331 | - | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQ453_RS24640 (4990328) | 4990328..4990963 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQ453_RS24645 (4990960) | 4990960..4991862 | - | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270056 WP_000558166.1 NZ_CP117184:c4987520-4987209 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270056 WP_001259011.1 NZ_CP117184:c4987212-4986766 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|