Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
| Location | 4426995..4427533 | Replicon | chromosome |
| Accession | NZ_CP117184 | ||
| Organism | Salmonella enterica subsp. enterica strain 123 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | M7RHM1 |
| Locus tag | PQ453_RS22000 | Protein ID | WP_001526148.1 |
| Coordinates | 4426995..4427270 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | M7RMV7 |
| Locus tag | PQ453_RS22005 | Protein ID | WP_000729713.1 |
| Coordinates | 4427273..4427533 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQ453_RS21995 (4424202) | 4424202..4426907 | + | 2706 | WP_000907029.1 | HTH-type transcriptional regulator MalT | - |
| PQ453_RS22000 (4426995) | 4426995..4427270 | - | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PQ453_RS22005 (4427273) | 4427273..4427533 | - | 261 | WP_000729713.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQ453_RS22010 (4427642) | 4427642..4428661 | - | 1020 | WP_000101027.1 | RNA 3'-terminal phosphate cyclase | - |
| PQ453_RS22015 (4428665) | 4428665..4429879 | - | 1215 | WP_001105521.1 | RNA-splicing ligase RtcB | - |
| PQ453_RS22020 (4430227) | 4430227..4430418 | - | 192 | Protein_4298 | TROVE domain-containing protein | - |
| PQ453_RS22025 (4430427) | 4430427..4431980 | - | 1554 | WP_000013007.1 | TROVE domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T270053 WP_001526148.1 NZ_CP117184:c4427270-4426995 [Salmonella enterica subsp. enterica]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SM83 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4D6P2L2 |