Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-RelB |
Location | 2123550..2124088 | Replicon | chromosome |
Accession | NZ_CP117181 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S |
Toxin (Protein)
Gene name | yafQ | Uniprot ID | M7RHM1 |
Locus tag | PQP75_RS10165 | Protein ID | WP_001526148.1 |
Coordinates | 2123813..2124088 (+) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A0A3V4SM47 |
Locus tag | PQP75_RS10160 | Protein ID | WP_017441598.1 |
Coordinates | 2123550..2123810 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP75_RS10145 (2119303) | 2119303..2120856 | + | 1554 | WP_017441601.1 | TROVE domain-containing protein | - |
PQP75_RS10150 (2121204) | 2121204..2122418 | + | 1215 | WP_017441600.1 | RNA-splicing ligase RtcB | - |
PQP75_RS10155 (2122422) | 2122422..2123441 | + | 1020 | WP_017441599.1 | RNA 3'-terminal phosphate cyclase | - |
PQP75_RS10160 (2123550) | 2123550..2123810 | + | 261 | WP_017441598.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP75_RS10165 (2123813) | 2123813..2124088 | + | 276 | WP_001526148.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PQP75_RS10170 (2124176) | 2124176..2126881 | - | 2706 | WP_000907030.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10739.34 Da Isoelectric Point: 8.8652
>T270028 WP_001526148.1 NZ_CP117181:2123813-2124088 [Salmonella enterica subsp. enterica serovar Mbandaka]
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
MGQREIEYSGQFQKDVKRAQKRHKDVGKLKTLMTLLIHHPFPLPAIYKDHPLQGSYSGYRDAHIEPDWILIYKITDECLR
FERTGTHADLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SM47 |