Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1584416..1585170 | Replicon | chromosome |
| Accession | NZ_CP117181 | ||
| Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SM_F28S | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PQP75_RS07625 | Protein ID | WP_000558166.1 |
| Coordinates | 1584416..1584727 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PQP75_RS07630 | Protein ID | WP_001259011.1 |
| Coordinates | 1584724..1585170 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP75_RS07595 (1580074) | 1580074..1580976 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PQP75_RS07600 (1580973) | 1580973..1581608 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PQP75_RS07605 (1581605) | 1581605..1582534 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PQP75_RS07610 (1582581) | 1582581..1582871 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PQP75_RS07615 (1582872) | 1582872..1583183 | - | 312 | WP_001159628.1 | hypothetical protein | - |
| PQP75_RS07620 (1583401) | 1583401..1584330 | + | 930 | WP_017441897.1 | alpha/beta hydrolase | - |
| PQP75_RS07625 (1584416) | 1584416..1584727 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PQP75_RS07630 (1584724) | 1584724..1585170 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PQP75_RS07635 (1585185) | 1585185..1586126 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PQP75_RS07640 (1586171) | 1586171..1586608 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PQP75_RS07645 (1586605) | 1586605..1587477 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PQP75_RS07650 (1587471) | 1587471..1588070 | - | 600 | WP_000965702.1 | glucose-1-phosphatase | - |
| PQP75_RS07655 (1588261) | 1588261..1589064 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PQP75_RS07660 (1589098) | 1589098..1589994 | - | 897 | WP_017441898.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T270025 WP_000558166.1 NZ_CP117181:1584416-1584727 [Salmonella enterica subsp. enterica serovar Mbandaka]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT270025 WP_001259011.1 NZ_CP117181:1584724-1585170 [Salmonella enterica subsp. enterica serovar Mbandaka]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|