Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 726960..727653 | Replicon | chromosome |
| Accession | NZ_CP117053 | ||
| Organism | Escherichia coli strain MLI106K4 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | NL407_RS04680 | Protein ID | WP_000415584.1 |
| Coordinates | 726960..727256 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NL407_RS04685 | Protein ID | WP_000650107.1 |
| Coordinates | 727258..727653 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL407_RS04645 (722048) | 722048..722362 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| NL407_RS04650 (722393) | 722393..722974 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| NL407_RS04655 (723293) | 723293..723625 | + | 333 | WP_023149630.1 | DUF2645 family protein | - |
| NL407_RS04660 (723671) | 723671..725020 | - | 1350 | WP_001401139.1 | quorum sensing histidine kinase QseC | - |
| NL407_RS04665 (725017) | 725017..725676 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| NL407_RS04670 (725828) | 725828..726220 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NL407_RS04675 (726273) | 726273..726755 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| NL407_RS04680 (726960) | 726960..727256 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NL407_RS04685 (727258) | 727258..727653 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NL407_RS04690 (727786) | 727786..729393 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| NL407_RS04695 (729531) | 729531..731789 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T269954 WP_000415584.1 NZ_CP117053:726960-727256 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT269954 WP_000650107.1 NZ_CP117053:727258-727653 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|