Detailed information of TA system TA269948

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 131914..132147
• Replicon: plasmid p174_MLI106-4
• Accession: NZ_CP117050
• Organism: Escherichia coli strain MLI106K4

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NL407_RS00795
• Protein ID: WP_001372321.1
• Coordinates: 131914..132039 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	132116..132147 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NL407_RS00755 (127288)	127288..127977	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NL407_RS00760 (128164)	128164..128547	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NL407_RS00765 (128868)	128868..129470	+	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
NL407_RS00770 (129767)	129767..130588	-	822	WP_001234426.1	DUF932 domain-containing protein	-
NL407_RS00775 (130706)	130706..130993	-	288	WP_000107535.1	hypothetical protein	-
NL407_RS00780 (131018)	131018..131224	-	207	WP_000547968.1	hypothetical protein	-
NL407_RS00785 (131294)	131294..131466	+	173	Protein_156	hypothetical protein	-
NL407_RS00790 (131464)	131464..131694	-	231	WP_071886920.1	hypothetical protein	-
NL407_RS00795 (131914)	131914..132039	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NL407_RS00800 (131981)	131981..132130	-	150	Protein_159	plasmid maintenance protein Mok	-
- (132116)	132116..132147	-	32	NuclAT_1	-	Antitoxin
- (132116)	132116..132147	-	32	NuclAT_1	-	Antitoxin
- (132116)	132116..132147	-	32	NuclAT_1	-	Antitoxin
- (132116)	132116..132147	-	32	NuclAT_1	-	Antitoxin
- (133589)	133589..133786	-	198	NuclAT_0	-	-
- (133589)	133589..133786	-	198	NuclAT_0	-	-
- (133589)	133589..133786	-	198	NuclAT_0	-	-
- (133589)	133589..133786	-	198	NuclAT_0	-	-
NL407_RS00810 (133598)	133598..133786	+	189	WP_001299721.1	hypothetical protein	-
NL407_RS00815 (133755)	133755..134517	-	763	Protein_162	plasmid SOS inhibition protein A	-
NL407_RS00820 (134514)	134514..134948	-	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
NL407_RS00825 (135003)	135003..135200	-	198	Protein_164	hypothetical protein	-
NL407_RS00830 (135228)	135228..135461	-	234	WP_000005990.1	DUF905 family protein	-
NL407_RS00835 (135529)	135529..136068	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
NL407_RS00840 (136094)	136094..136300	-	207	WP_000275856.1	hypothetical protein	-
NL407_RS00845 (136540)	136540..136785	-	246	WP_071533131.1	hypothetical protein	-
NL407_RS00850 (136710)	136710..136910	-	201	WP_025492130.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD	iutA / iucD / iucC / iucB / iucA	1..174496	174496

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T269948 WP_001372321.1 NZ_CP117050:c132039-131914 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 32 bp

>AT269948 NZ_CP117050:c132147-132116 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin