Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 131914..132147 | Replicon | plasmid p174_MLI106-4 |
| Accession | NZ_CP117050 | ||
| Organism | Escherichia coli strain MLI106K4 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NL407_RS00795 | Protein ID | WP_001372321.1 |
| Coordinates | 131914..132039 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 132116..132147 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL407_RS00755 (127288) | 127288..127977 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| NL407_RS00760 (128164) | 128164..128547 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NL407_RS00765 (128868) | 128868..129470 | + | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| NL407_RS00770 (129767) | 129767..130588 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| NL407_RS00775 (130706) | 130706..130993 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| NL407_RS00780 (131018) | 131018..131224 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| NL407_RS00785 (131294) | 131294..131466 | + | 173 | Protein_156 | hypothetical protein | - |
| NL407_RS00790 (131464) | 131464..131694 | - | 231 | WP_071886920.1 | hypothetical protein | - |
| NL407_RS00795 (131914) | 131914..132039 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NL407_RS00800 (131981) | 131981..132130 | - | 150 | Protein_159 | plasmid maintenance protein Mok | - |
| - (132116) | 132116..132147 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (132116) | 132116..132147 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (132116) | 132116..132147 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (132116) | 132116..132147 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (133589) | 133589..133786 | - | 198 | NuclAT_0 | - | - |
| - (133589) | 133589..133786 | - | 198 | NuclAT_0 | - | - |
| - (133589) | 133589..133786 | - | 198 | NuclAT_0 | - | - |
| - (133589) | 133589..133786 | - | 198 | NuclAT_0 | - | - |
| NL407_RS00810 (133598) | 133598..133786 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| NL407_RS00815 (133755) | 133755..134517 | - | 763 | Protein_162 | plasmid SOS inhibition protein A | - |
| NL407_RS00820 (134514) | 134514..134948 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| NL407_RS00825 (135003) | 135003..135200 | - | 198 | Protein_164 | hypothetical protein | - |
| NL407_RS00830 (135228) | 135228..135461 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| NL407_RS00835 (135529) | 135529..136068 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| NL407_RS00840 (136094) | 136094..136300 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| NL407_RS00845 (136540) | 136540..136785 | - | 246 | WP_071533131.1 | hypothetical protein | - |
| NL407_RS00850 (136710) | 136710..136910 | - | 201 | WP_025492130.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..174496 | 174496 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T269948 WP_001372321.1 NZ_CP117050:c132039-131914 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT269948 NZ_CP117050:c132147-132116 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|