Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 86798..87052 | Replicon | plasmid p174_MLI106-4 |
| Accession | NZ_CP117050 | ||
| Organism | Escherichia coli strain MLI106K4 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NL407_RS00520 | Protein ID | WP_001312851.1 |
| Coordinates | 86798..86947 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 86991..87052 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL407_RS00490 (82045) | 82045..82956 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| NL407_RS00495 (82967) | 82967..84187 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| NL407_RS00500 (84894) | 84894..85508 | + | 615 | Protein_99 | VENN motif pre-toxin domain-containing protein | - |
| NL407_RS00505 (85508) | 85508..85954 | - | 447 | Protein_100 | plasmid replication initiator RepA | - |
| NL407_RS00510 (85947) | 85947..86021 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| NL407_RS00515 (86257) | 86257..86514 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| NL407_RS00520 (86798) | 86798..86947 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (86991) | 86991..87052 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (86991) | 86991..87052 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (86991) | 86991..87052 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (86991) | 86991..87052 | + | 62 | NuclAT_2 | - | Antitoxin |
| NL407_RS00525 (87191) | 87191..87373 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| NL407_RS00530 (87474) | 87474..88090 | + | 617 | Protein_105 | IS1-like element IS1A family transposase | - |
| NL407_RS00535 (88128) | 88128..89699 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| NL407_RS00540 (89719) | 89719..90066 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NL407_RS00545 (90066) | 90066..90743 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| NL407_RS00550 (90798) | 90798..90887 | + | 90 | Protein_109 | IS1 family transposase | - |
| NL407_RS00555 (91188) | 91188..91400 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..174496 | 174496 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T269944 WP_001312851.1 NZ_CP117050:c86947-86798 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT269944 NZ_CP117050:86991-87052 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|