Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-rdlD/SymE(toxin) |
Location | 4228758..4229170 | Replicon | chromosome |
Accession | NZ_CP117049 | ||
Organism | Escherichia coli strain MLI106K2 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | NL423_RS21600 | Protein ID | WP_000132601.1 |
Coordinates | 4228829..4229170 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 4228758..4228834 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL423_RS21590 (4225621) | 4225621..4227210 | + | 1590 | WP_001063200.1 | type I restriction-modification system methyltransferase | - |
NL423_RS21595 (4227207) | 4227207..4228601 | + | 1395 | WP_001272445.1 | type I restriction-modification system specificity subunit | - |
- (4228758) | 4228758..4228834 | - | 77 | NuclAT_14 | - | Antitoxin |
- (4228758) | 4228758..4228834 | - | 77 | NuclAT_14 | - | Antitoxin |
- (4228758) | 4228758..4228834 | - | 77 | NuclAT_14 | - | Antitoxin |
- (4228758) | 4228758..4228834 | - | 77 | NuclAT_14 | - | Antitoxin |
- (4228758) | 4228758..4228834 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4228758) | 4228758..4228834 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4228758) | 4228758..4228834 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4228758) | 4228758..4228834 | - | 77 | NuclAT_15 | - | Antitoxin |
NL423_RS21600 (4228829) | 4228829..4229170 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
NL423_RS21605 (4229332) | 4229332..4230711 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
NL423_RS21610 (4230711) | 4230711..4231757 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T269937 WP_000132601.1 NZ_CP117049:4228829-4229170 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT269937 NZ_CP117049:c4228834-4228758 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|