Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3868930..3869624 | Replicon | chromosome |
Accession | NZ_CP117049 | ||
Organism | Escherichia coli strain MLI106K2 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | NL423_RS19950 | Protein ID | WP_001263489.1 |
Coordinates | 3868930..3869328 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NL423_RS19955 | Protein ID | WP_000554758.1 |
Coordinates | 3869331..3869624 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3864518) | 3864518..3864598 | - | 81 | NuclAT_13 | - | - |
- (3864518) | 3864518..3864598 | - | 81 | NuclAT_13 | - | - |
- (3864518) | 3864518..3864598 | - | 81 | NuclAT_13 | - | - |
- (3864518) | 3864518..3864598 | - | 81 | NuclAT_13 | - | - |
NL423_RS19925 (3865194) | 3865194..3865652 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NL423_RS19930 (3865913) | 3865913..3867370 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
NL423_RS19935 (3867427) | 3867427..3867948 | - | 522 | Protein_3684 | peptide chain release factor H | - |
NL423_RS19940 (3867944) | 3867944..3868150 | - | 207 | Protein_3685 | RtcB family protein | - |
NL423_RS19945 (3868468) | 3868468..3868920 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
NL423_RS19950 (3868930) | 3868930..3869328 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NL423_RS19955 (3869331) | 3869331..3869624 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NL423_RS19960 (3869676) | 3869676..3870731 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NL423_RS19965 (3870802) | 3870802..3871587 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NL423_RS19970 (3871559) | 3871559..3873271 | + | 1713 | Protein_3691 | flagellar biosynthesis protein FlhA | - |
NL423_RS19975 (3873495) | 3873495..3873992 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3850825..3884210 | 33385 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T269935 WP_001263489.1 NZ_CP117049:c3869328-3868930 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |