Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1066175..1066902 | Replicon | chromosome |
| Accession | NZ_CP117049 | ||
| Organism | Escherichia coli strain MLI106K2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A829L2T9 |
| Locus tag | NL423_RS06325 | Protein ID | WP_001521139.1 |
| Coordinates | 1066175..1066486 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL423_RS06330 | Protein ID | WP_000126294.1 |
| Coordinates | 1066483..1066902 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL423_RS06300 (1062110) | 1062110..1063819 | + | 1710 | WP_001521140.1 | formate hydrogenlyase subunit HycE | - |
| NL423_RS06305 (1063829) | 1063829..1064371 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| NL423_RS06310 (1064371) | 1064371..1065138 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| NL423_RS06315 (1065135) | 1065135..1065545 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| NL423_RS06320 (1065538) | 1065538..1066008 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| NL423_RS06325 (1066175) | 1066175..1066486 | + | 312 | WP_001521139.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NL423_RS06330 (1066483) | 1066483..1066902 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NL423_RS06335 (1066981) | 1066981..1068405 | - | 1425 | WP_020234028.1 | 6-phospho-beta-glucosidase AscB | - |
| NL423_RS06340 (1068414) | 1068414..1069871 | - | 1458 | WP_020234027.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| NL423_RS06345 (1070131) | 1070131..1071141 | + | 1011 | WP_015912547.1 | DNA-binding transcriptional regulator AscG | - |
| NL423_RS06350 (1071290) | 1071290..1071817 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12493.23 Da Isoelectric Point: 9.4783
>T269924 WP_001521139.1 NZ_CP117049:1066175-1066486 [Escherichia coli]
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT269924 WP_000126294.1 NZ_CP117049:1066483-1066902 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|