Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 608317..609116 | Replicon | chromosome |
Accession | NZ_CP117049 | ||
Organism | Escherichia coli strain MLI106K2 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | D3GWU5 |
Locus tag | NL423_RS04080 | Protein ID | WP_000347272.1 |
Coordinates | 608317..608781 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | NL423_RS04085 | Protein ID | WP_001307405.1 |
Coordinates | 608781..609116 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL423_RS04050 (603318) | 603318..603752 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
NL423_RS04055 (603770) | 603770..604648 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
NL423_RS04060 (604638) | 604638..605417 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
NL423_RS04065 (605428) | 605428..605901 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
NL423_RS04070 (605924) | 605924..607204 | - | 1281 | WP_001521382.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
NL423_RS04075 (607453) | 607453..608262 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
NL423_RS04080 (608317) | 608317..608781 | - | 465 | WP_000347272.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
NL423_RS04085 (608781) | 608781..609116 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
NL423_RS04090 (609265) | 609265..610836 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
NL423_RS04095 (611211) | 611211..612545 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
NL423_RS04100 (612561) | 612561..613331 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17832.26 Da Isoelectric Point: 9.6924
>T269920 WP_000347272.1 NZ_CP117049:c608781-608317 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829KUD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |