Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 131915..132148 | Replicon | plasmid p174_MLI106-2 |
| Accession | NZ_CP117046 | ||
| Organism | Escherichia coli strain MLI106K2 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NL423_RS00790 | Protein ID | WP_001372321.1 |
| Coordinates | 131915..132040 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 132117..132148 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL423_RS00750 (127289) | 127289..127978 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| NL423_RS00755 (128165) | 128165..128548 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NL423_RS00760 (128869) | 128869..129471 | + | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| NL423_RS00765 (129768) | 129768..130589 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| NL423_RS00770 (130707) | 130707..130994 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| NL423_RS00775 (131019) | 131019..131225 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| NL423_RS00780 (131295) | 131295..131467 | + | 173 | Protein_155 | hypothetical protein | - |
| NL423_RS00785 (131465) | 131465..131695 | - | 231 | WP_071886920.1 | hypothetical protein | - |
| NL423_RS00790 (131915) | 131915..132040 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NL423_RS00795 (131982) | 131982..132131 | - | 150 | Protein_158 | plasmid maintenance protein Mok | - |
| - (132117) | 132117..132148 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (132117) | 132117..132148 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (132117) | 132117..132148 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (132117) | 132117..132148 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (133590) | 133590..133787 | - | 198 | NuclAT_0 | - | - |
| - (133590) | 133590..133787 | - | 198 | NuclAT_0 | - | - |
| - (133590) | 133590..133787 | - | 198 | NuclAT_0 | - | - |
| - (133590) | 133590..133787 | - | 198 | NuclAT_0 | - | - |
| NL423_RS00805 (133599) | 133599..133787 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| NL423_RS00810 (133756) | 133756..134518 | - | 763 | Protein_161 | plasmid SOS inhibition protein A | - |
| NL423_RS00815 (134515) | 134515..134949 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| NL423_RS00820 (135004) | 135004..135201 | - | 198 | Protein_163 | hypothetical protein | - |
| NL423_RS00825 (135229) | 135229..135462 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| NL423_RS00830 (135530) | 135530..136069 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| NL423_RS00835 (136095) | 136095..136301 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| NL423_RS00840 (136541) | 136541..136786 | - | 246 | WP_071533131.1 | hypothetical protein | - |
| NL423_RS00845 (136711) | 136711..136911 | - | 201 | WP_025492130.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..174497 | 174497 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T269915 WP_001372321.1 NZ_CP117046:c132040-131915 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT269915 NZ_CP117046:c132148-132117 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|