Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) hok-sok/-
Location 131915..132148 Replicon plasmid p174_MLI106-2
Accession NZ_CP117046
Organism Escherichia coli strain MLI106K2

Toxin (Protein)


Gene name hok Uniprot ID -
Locus tag NL423_RS00790 Protein ID WP_001372321.1
Coordinates 131915..132040 (-) Length 42 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 132117..132148 (-)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL423_RS00750 (127289) 127289..127978 - 690 WP_000283385.1 conjugal transfer transcriptional regulator TraJ -
NL423_RS00755 (128165) 128165..128548 - 384 WP_001151524.1 conjugal transfer relaxosome DNA-binding protein TraM -
NL423_RS00760 (128869) 128869..129471 + 603 WP_013362798.1 transglycosylase SLT domain-containing protein -
NL423_RS00765 (129768) 129768..130589 - 822 WP_001234426.1 DUF932 domain-containing protein -
NL423_RS00770 (130707) 130707..130994 - 288 WP_000107535.1 hypothetical protein -
NL423_RS00775 (131019) 131019..131225 - 207 WP_000547968.1 hypothetical protein -
NL423_RS00780 (131295) 131295..131467 + 173 Protein_155 hypothetical protein -
NL423_RS00785 (131465) 131465..131695 - 231 WP_071886920.1 hypothetical protein -
NL423_RS00790 (131915) 131915..132040 - 126 WP_001372321.1 type I toxin-antitoxin system Hok family toxin Toxin
NL423_RS00795 (131982) 131982..132131 - 150 Protein_158 plasmid maintenance protein Mok -
- (132117) 132117..132148 - 32 NuclAT_1 - Antitoxin
- (132117) 132117..132148 - 32 NuclAT_1 - Antitoxin
- (132117) 132117..132148 - 32 NuclAT_1 - Antitoxin
- (132117) 132117..132148 - 32 NuclAT_1 - Antitoxin
- (133590) 133590..133787 - 198 NuclAT_0 - -
- (133590) 133590..133787 - 198 NuclAT_0 - -
- (133590) 133590..133787 - 198 NuclAT_0 - -
- (133590) 133590..133787 - 198 NuclAT_0 - -
NL423_RS00805 (133599) 133599..133787 + 189 WP_001299721.1 hypothetical protein -
NL423_RS00810 (133756) 133756..134518 - 763 Protein_161 plasmid SOS inhibition protein A -
NL423_RS00815 (134515) 134515..134949 - 435 WP_000845937.1 conjugation system SOS inhibitor PsiB -
NL423_RS00820 (135004) 135004..135201 - 198 Protein_163 hypothetical protein -
NL423_RS00825 (135229) 135229..135462 - 234 WP_000005990.1 DUF905 family protein -
NL423_RS00830 (135530) 135530..136069 - 540 WP_000290840.1 single-stranded DNA-binding protein -
NL423_RS00835 (136095) 136095..136301 - 207 WP_000275856.1 hypothetical protein -
NL423_RS00840 (136541) 136541..136786 - 246 WP_071533131.1 hypothetical protein -
NL423_RS00845 (136711) 136711..136911 - 201 WP_025492130.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD iutA / iucD / iucC / iucB / iucA 1..174497 174497


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(2-37)


Sequences


Toxin        


Download         Length: 42 a.a.        Molecular weight: 4780.69 Da        Isoelectric Point: 8.5110

>T269915 WP_001372321.1 NZ_CP117046:c132040-131915 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 126 bp


Antitoxin


Download         Length: 32 bp

>AT269915 NZ_CP117046:c132148-132117 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Download structure file

References