Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 86799..87053 | Replicon | plasmid p174_MLI106-2 |
| Accession | NZ_CP117046 | ||
| Organism | Escherichia coli strain MLI106K2 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NL423_RS00520 | Protein ID | WP_001312851.1 |
| Coordinates | 86799..86948 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 86992..87053 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL423_RS00490 (82046) | 82046..82957 | - | 912 | WP_000440183.1 | carbamate kinase | - |
| NL423_RS00495 (82968) | 82968..84188 | - | 1221 | WP_000410951.1 | arginine deiminase | - |
| NL423_RS00500 (84895) | 84895..85509 | + | 615 | Protein_99 | VENN motif pre-toxin domain-containing protein | - |
| NL423_RS00505 (85509) | 85509..85955 | - | 447 | Protein_100 | plasmid replication initiator RepA | - |
| NL423_RS00510 (85948) | 85948..86022 | - | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| NL423_RS00515 (86258) | 86258..86515 | - | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| NL423_RS00520 (86799) | 86799..86948 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (86992) | 86992..87053 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (86992) | 86992..87053 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (86992) | 86992..87053 | + | 62 | NuclAT_2 | - | Antitoxin |
| - (86992) | 86992..87053 | + | 62 | NuclAT_2 | - | Antitoxin |
| NL423_RS00525 (87192) | 87192..87374 | - | 183 | WP_000968309.1 | hypothetical protein | - |
| NL423_RS00530 (87475) | 87475..88091 | + | 617 | Protein_105 | IS1-like element IS1A family transposase | - |
| NL423_RS00535 (88129) | 88129..89700 | - | 1572 | WP_023149734.1 | IS66-like element ISCro1 family transposase | - |
| NL423_RS00540 (89720) | 89720..90067 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NL423_RS00545 (90067) | 90067..90744 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| NL423_RS00550 (90799) | 90799..90888 | + | 90 | Protein_109 | IS1 family transposase | - |
| NL423_RS00555 (91189) | 91189..91401 | - | 213 | WP_005012601.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / catA1 / tet(B) / mph(A) / sul1 / qacE / aadA5 / aac(3)-IId / blaTEM-1B / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..174497 | 174497 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T269911 WP_001312851.1 NZ_CP117046:c86948-86799 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT269911 NZ_CP117046:86992-87053 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
