Detailed information of TA system TA269904

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 78844..79270
• Replicon: plasmid IncFIB/IncFIC
• Accession: NZ_CP117035
• Organism: Salmonella enterica strain PIW95_S14_0299

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PQP07_RS26160
• Protein ID: WP_001372321.1
• Coordinates: 78844..78969 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	79046..79270 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PQP07_RS26120 (74213)	74213..74902	-	690	WP_039002187.1	conjugal transfer transcriptional regulator TraJ	-
PQP07_RS26125 (75089)	75089..75472	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PQP07_RS26130 (75805)	75805..76395	+	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
PQP07_RS26135 (76692)	76692..77513	-	822	WP_001234469.1	DUF932 domain-containing protein	-
PQP07_RS26140 (77635)	77635..77922	-	288	WP_000107535.1	hypothetical protein	-
PQP07_RS26145 (77947)	77947..78153	-	207	WP_000547968.1	hypothetical protein	-
PQP07_RS26150 (78223)	78223..78396	+	174	Protein_89	hypothetical protein	-
PQP07_RS26155 (78394)	78394..78624	-	231	WP_001426396.1	hypothetical protein	-
PQP07_RS26160 (78844)	78844..78969	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PQP07_RS26165 (78911)	78911..79060	-	150	Protein_92	plasmid maintenance protein Mok	-
- (79046)	79046..79270	-	225	NuclAT_0	-	Antitoxin
- (79046)	79046..79270	-	225	NuclAT_0	-	Antitoxin
- (79046)	79046..79270	-	225	NuclAT_0	-	Antitoxin
- (79046)	79046..79270	-	225	NuclAT_0	-	Antitoxin
PQP07_RS26170 (79282)	79282..80001	-	720	WP_001276232.1	plasmid SOS inhibition protein A	-
PQP07_RS26175 (79998)	79998..80432	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PQP07_RS26180 (80487)	80487..82445	-	1959	WP_039000998.1	ParB/RepB/Spo0J family partition protein	-
PQP07_RS26185 (82510)	82510..82743	-	234	WP_000005987.1	DUF905 family protein	-
PQP07_RS26190 (82800)	82800..83339	-	540	WP_032332913.1	single-stranded DNA-binding protein	-
PQP07_RS26195 (83365)	83365..83571	-	207	WP_000275853.1	hypothetical protein	-
PQP07_RS26200 (83812)	83812..84039	-	228	WP_071961421.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(3')-Ia / tet(M) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / mef(B) / blaTEM-1B	-	1..133901	133901

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T269904 WP_001372321.1 NZ_CP117035:c78969-78844 [Salmonella enterica]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT269904 NZ_CP117035:c79270-79046 [Salmonella enterica]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin