Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 41005..41259 | Replicon | plasmid IncFIB/IncFIC |
| Accession | NZ_CP117035 | ||
| Organism | Salmonella enterica strain PIW95_S14_0299 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PQP07_RS25945 | Protein ID | WP_001312851.1 |
| Coordinates | 41005..41154 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 41198..41259 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP07_RS25910 (37026) | 37026..37526 | + | 501 | Protein_41 | Tn3 family transposase | - |
| PQP07_RS25915 (37560) | 37560..37748 | + | 189 | Protein_42 | IS3 family transposase | - |
| PQP07_RS25920 (37823) | 37823..38110 | - | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PQP07_RS25925 (38107) | 38107..38358 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PQP07_RS25930 (39324) | 39324..40181 | - | 858 | WP_039002220.1 | incFII family plasmid replication initiator RepA | - |
| PQP07_RS25935 (40174) | 40174..40248 | - | 75 | WP_061357229.1 | RepA leader peptide Tap | - |
| PQP07_RS25940 (40480) | 40480..40737 | - | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
| PQP07_RS25945 (41005) | 41005..41154 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (41198) | 41198..41259 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (41198) | 41198..41259 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (41198) | 41198..41259 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (41198) | 41198..41259 | + | 62 | NuclAT_1 | - | Antitoxin |
| PQP07_RS25950 (41601) | 41601..41813 | - | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
| PQP07_RS25955 (41948) | 41948..42508 | - | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
| PQP07_RS25960 (42563) | 42563..43306 | - | 744 | WP_039002216.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / tet(M) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / mef(B) / blaTEM-1B | - | 1..133901 | 133901 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T269900 WP_001312851.1 NZ_CP117035:c41154-41005 [Salmonella enterica]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT269900 NZ_CP117035:41198-41259 [Salmonella enterica]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|