Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 41005..41259 Replicon plasmid IncFIB/IncFIC
Accession NZ_CP117035
Organism Salmonella enterica strain PIW95_S14_0299

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag PQP07_RS25945 Protein ID WP_001312851.1
Coordinates 41005..41154 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 41198..41259 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP07_RS25910 (37026) 37026..37526 + 501 Protein_41 Tn3 family transposase -
PQP07_RS25915 (37560) 37560..37748 + 189 Protein_42 IS3 family transposase -
PQP07_RS25920 (37823) 37823..38110 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin -
PQP07_RS25925 (38107) 38107..38358 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
PQP07_RS25930 (39324) 39324..40181 - 858 WP_039002220.1 incFII family plasmid replication initiator RepA -
PQP07_RS25935 (40174) 40174..40248 - 75 WP_061357229.1 RepA leader peptide Tap -
PQP07_RS25940 (40480) 40480..40737 - 258 WP_001541895.1 replication regulatory protein RepA -
PQP07_RS25945 (41005) 41005..41154 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (41198) 41198..41259 + 62 NuclAT_1 - Antitoxin
- (41198) 41198..41259 + 62 NuclAT_1 - Antitoxin
- (41198) 41198..41259 + 62 NuclAT_1 - Antitoxin
- (41198) 41198..41259 + 62 NuclAT_1 - Antitoxin
PQP07_RS25950 (41601) 41601..41813 - 213 WP_001541896.1 ANR family transcriptional regulator -
PQP07_RS25955 (41948) 41948..42508 - 561 WP_000139310.1 fertility inhibition protein FinO -
PQP07_RS25960 (42563) 42563..43306 - 744 WP_039002216.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / tet(M) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / mef(B) / blaTEM-1B - 1..133901 133901


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T269900 WP_001312851.1 NZ_CP117035:c41154-41005 [Salmonella enterica]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT269900 NZ_CP117035:41198-41259 [Salmonella enterica]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References