Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2466876..2467398 | Replicon | chromosome |
Accession | NZ_CP117033 | ||
Organism | Salmonella enterica strain PIW95_S14_0299 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | PQP07_RS12150 | Protein ID | WP_000221343.1 |
Coordinates | 2467114..2467398 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQP07_RS12145 | Protein ID | WP_000885424.1 |
Coordinates | 2466876..2467124 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP07_RS12120 (2462092) | 2462092..2463558 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
PQP07_RS12125 (2464366) | 2464366..2465080 | + | 715 | Protein_2372 | helix-turn-helix domain-containing protein | - |
PQP07_RS12130 (2465136) | 2465136..2466044 | - | 909 | WP_010989018.1 | hypothetical protein | - |
PQP07_RS12135 (2466187) | 2466187..2466519 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
PQP07_RS12140 (2466509) | 2466509..2466724 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PQP07_RS12145 (2466876) | 2466876..2467124 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQP07_RS12150 (2467114) | 2467114..2467398 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP07_RS12155 (2467569) | 2467569..2467958 | + | 390 | WP_000194089.1 | RidA family protein | - |
PQP07_RS12160 (2468010) | 2468010..2469089 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQP07_RS12165 (2469282) | 2469282..2469770 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQP07_RS12170 (2469815) | 2469815..2471323 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2462095..2474180 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T269889 WP_000221343.1 NZ_CP117033:2467114-2467398 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |