Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4175960..4176654 Replicon chromosome
Accession NZ_CP117020
Organism Escherichia coli strain MLI106K3

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NL424_RS20320 Protein ID WP_001263491.1
Coordinates 4176256..4176654 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NL424_RS20315 Protein ID WP_000554755.1
Coordinates 4175960..4176253 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL424_RS20290 (4171581) 4171581..4171937 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
NL424_RS20295 (4171930) 4171930..4172208 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NL424_RS20300 (4172313) 4172313..4174025 - 1713 Protein_3886 flagellar biosynthesis protein FlhA -
NL424_RS20305 (4173997) 4173997..4174782 + 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NL424_RS20310 (4174853) 4174853..4175908 + 1056 WP_001550655.1 DNA polymerase IV -
NL424_RS20315 (4175960) 4175960..4176253 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL424_RS20320 (4176256) 4176256..4176654 + 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL424_RS20325 (4176664) 4176664..4177116 + 453 WP_019842500.1 GNAT family N-acetyltransferase -
NL424_RS20330 (4177362) 4177362..4177568 + 207 Protein_3892 RtcB family protein -
NL424_RS20335 (4177564) 4177564..4177916 + 353 Protein_3893 peptide chain release factor H -
NL424_RS20340 (4177973) 4177973..4179430 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NL424_RS20345 (4179691) 4179691..4180149 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (4180745) 4180745..4180825 + 81 NuclAT_9 - -
- (4180745) 4180745..4180825 + 81 NuclAT_9 - -
- (4180745) 4180745..4180825 + 81 NuclAT_9 - -
- (4180745) 4180745..4180825 + 81 NuclAT_9 - -
NL424_RS20350 (4180241) 4180241..4181485 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T269869 WP_001263491.1 NZ_CP117020:4176256-4176654 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT269869 WP_000554755.1 NZ_CP117020:4175960-4176253 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References