Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3276320..3276922 | Replicon | chromosome |
Accession | NZ_CP117020 | ||
Organism | Escherichia coli strain MLI106K3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NL424_RS16135 | Protein ID | WP_000897305.1 |
Coordinates | 3276320..3276631 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NL424_RS16140 | Protein ID | WP_000356395.1 |
Coordinates | 3276632..3276922 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL424_RS16110 (3271362) | 3271362..3271799 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NL424_RS16115 (3271844) | 3271844..3272785 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
NL424_RS16120 (3273201) | 3273201..3274088 | + | 888 | Protein_3077 | hypothetical protein | - |
NL424_RS16125 (3274101) | 3274101..3275015 | + | 915 | WP_109553727.1 | transposase | - |
NL424_RS16130 (3275183) | 3275183..3276091 | - | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
NL424_RS16135 (3276320) | 3276320..3276631 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NL424_RS16140 (3276632) | 3276632..3276922 | + | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
NL424_RS16145 (3277007) | 3277007..3277228 | + | 222 | WP_001550354.1 | hypothetical protein | - |
NL424_RS16150 (3277280) | 3277280..3277558 | + | 279 | WP_001315112.1 | hypothetical protein | - |
NL424_RS16155 (3277977) | 3277977..3278195 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NL424_RS16160 (3278414) | 3278414..3278656 | + | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
NL424_RS16165 (3278838) | 3278838..3279767 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
NL424_RS16170 (3279764) | 3279764..3280399 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NL424_RS16175 (3280396) | 3280396..3281298 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T269865 WP_000897305.1 NZ_CP117020:3276320-3276631 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|