Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 339087..339309 | Replicon | chromosome |
| Accession | NZ_CP117020 | ||
| Organism | Escherichia coli strain MLI106K3 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | NL424_RS02050 | Protein ID | WP_000170955.1 |
| Coordinates | 339087..339194 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 339242..339309 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL424_RS02020 (334768) | 334768..335601 | + | 834 | WP_000456570.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| NL424_RS02025 (335598) | 335598..335990 | + | 393 | WP_000200377.1 | invasion regulator SirB2 | - |
| NL424_RS02030 (335994) | 335994..336803 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| NL424_RS02035 (336839) | 336839..337693 | + | 855 | WP_085018032.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| NL424_RS02040 (337888) | 337888..338346 | + | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
| NL424_RS02045 (338552) | 338552..338659 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_29 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_29 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_29 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_29 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_33 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_33 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_33 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_33 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_37 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_37 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_37 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_37 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_41 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_41 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_41 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_41 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_42 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_42 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_42 | - | - |
| - (338707) | 338707..338773 | + | 67 | NuclAT_42 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_11 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_11 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_11 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_11 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_13 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_13 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_13 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_13 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_15 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_15 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_15 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_15 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_17 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_17 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_17 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_17 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_19 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_19 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_19 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_19 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_21 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_21 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_21 | - | - |
| - (338709) | 338709..338774 | + | 66 | NuclAT_21 | - | - |
| NL424_RS02050 (339087) | 339087..339194 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_10 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_10 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_10 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_10 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_12 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_12 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_12 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_12 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_14 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_14 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_14 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_14 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_18 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_18 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_18 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_18 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_20 | - | Antitoxin |
| - (339242) | 339242..339309 | + | 68 | NuclAT_20 | - | Antitoxin |
| NL424_RS02055 (339599) | 339599..340699 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| NL424_RS02060 (340969) | 340969..341199 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| NL424_RS02065 (341357) | 341357..342052 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| NL424_RS02070 (342096) | 342096..342449 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| NL424_RS02075 (342635) | 342635..344029 | + | 1395 | WP_001718153.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 337888..338346 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T269853 WP_000170955.1 NZ_CP117020:c339194-339087 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT269853 NZ_CP117020:339242-339309 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|