Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 339087..339309 Replicon chromosome
Accession NZ_CP117020
Organism Escherichia coli strain MLI106K3

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag NL424_RS02050 Protein ID WP_000170955.1
Coordinates 339087..339194 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 339242..339309 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL424_RS02020 (334768) 334768..335601 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
NL424_RS02025 (335598) 335598..335990 + 393 WP_000200377.1 invasion regulator SirB2 -
NL424_RS02030 (335994) 335994..336803 + 810 WP_001257044.1 invasion regulator SirB1 -
NL424_RS02035 (336839) 336839..337693 + 855 WP_085018032.1 3-deoxy-8-phosphooctulonate synthase -
NL424_RS02040 (337888) 337888..338346 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
NL424_RS02045 (338552) 338552..338659 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein -
- (338707) 338707..338773 + 67 NuclAT_29 - -
- (338707) 338707..338773 + 67 NuclAT_29 - -
- (338707) 338707..338773 + 67 NuclAT_29 - -
- (338707) 338707..338773 + 67 NuclAT_29 - -
- (338707) 338707..338773 + 67 NuclAT_33 - -
- (338707) 338707..338773 + 67 NuclAT_33 - -
- (338707) 338707..338773 + 67 NuclAT_33 - -
- (338707) 338707..338773 + 67 NuclAT_33 - -
- (338707) 338707..338773 + 67 NuclAT_37 - -
- (338707) 338707..338773 + 67 NuclAT_37 - -
- (338707) 338707..338773 + 67 NuclAT_37 - -
- (338707) 338707..338773 + 67 NuclAT_37 - -
- (338707) 338707..338773 + 67 NuclAT_41 - -
- (338707) 338707..338773 + 67 NuclAT_41 - -
- (338707) 338707..338773 + 67 NuclAT_41 - -
- (338707) 338707..338773 + 67 NuclAT_41 - -
- (338707) 338707..338773 + 67 NuclAT_42 - -
- (338707) 338707..338773 + 67 NuclAT_42 - -
- (338707) 338707..338773 + 67 NuclAT_42 - -
- (338707) 338707..338773 + 67 NuclAT_42 - -
- (338709) 338709..338774 + 66 NuclAT_11 - -
- (338709) 338709..338774 + 66 NuclAT_11 - -
- (338709) 338709..338774 + 66 NuclAT_11 - -
- (338709) 338709..338774 + 66 NuclAT_11 - -
- (338709) 338709..338774 + 66 NuclAT_13 - -
- (338709) 338709..338774 + 66 NuclAT_13 - -
- (338709) 338709..338774 + 66 NuclAT_13 - -
- (338709) 338709..338774 + 66 NuclAT_13 - -
- (338709) 338709..338774 + 66 NuclAT_15 - -
- (338709) 338709..338774 + 66 NuclAT_15 - -
- (338709) 338709..338774 + 66 NuclAT_15 - -
- (338709) 338709..338774 + 66 NuclAT_15 - -
- (338709) 338709..338774 + 66 NuclAT_17 - -
- (338709) 338709..338774 + 66 NuclAT_17 - -
- (338709) 338709..338774 + 66 NuclAT_17 - -
- (338709) 338709..338774 + 66 NuclAT_17 - -
- (338709) 338709..338774 + 66 NuclAT_19 - -
- (338709) 338709..338774 + 66 NuclAT_19 - -
- (338709) 338709..338774 + 66 NuclAT_19 - -
- (338709) 338709..338774 + 66 NuclAT_19 - -
- (338709) 338709..338774 + 66 NuclAT_21 - -
- (338709) 338709..338774 + 66 NuclAT_21 - -
- (338709) 338709..338774 + 66 NuclAT_21 - -
- (338709) 338709..338774 + 66 NuclAT_21 - -
NL424_RS02050 (339087) 339087..339194 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (339242) 339242..339309 + 68 NuclAT_10 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_10 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_10 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_10 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_12 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_12 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_12 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_12 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_14 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_14 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_14 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_14 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_16 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_16 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_16 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_16 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_18 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_18 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_18 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_18 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_20 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_20 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_20 - Antitoxin
- (339242) 339242..339309 + 68 NuclAT_20 - Antitoxin
NL424_RS02055 (339599) 339599..340699 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
NL424_RS02060 (340969) 340969..341199 + 231 WP_001146444.1 putative cation transport regulator ChaB -
NL424_RS02065 (341357) 341357..342052 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
NL424_RS02070 (342096) 342096..342449 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
NL424_RS02075 (342635) 342635..344029 + 1395 WP_001718153.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 337888..338346 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T269853 WP_000170955.1 NZ_CP117020:c339194-339087 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 68 bp

>AT269853 NZ_CP117020:339242-339309 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829J2A9


Antitoxin

Download structure file

References