269843

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4079990..4080684 Replicon chromosome
Accession NZ_CP117016
Organism Escherichia coli strain MLI121

Toxin (Protein)


Gene name yafO Uniprot ID A0A1X0YXS1
Locus tag NL415_RS20500 Protein ID WP_001263484.1
Coordinates 4080286..4080684 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NL415_RS20495 Protein ID WP_000554755.1
Coordinates 4079990..4080283 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL415_RS20460 (4075082) 4075082..4075348 + 267 Protein_3863 sigma 54-interacting transcriptional regulator -
NL415_RS20465 (4075405) 4075405..4076102 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
NL415_RS20470 (4076119) 4076119..4076274 + 156 Protein_3865 flagellar basal body protein FliL -
NL415_RS20475 (4076294) 4076294..4077010 + 717 WP_000938719.1 FliA/WhiG family RNA polymerase sigma factor -
NL415_RS20480 (4077023) 4077023..4077886 + 864 WP_001169519.1 flagellar motor stator protein MotA -
NL415_RS20485 (4077889) 4077889..4078812 + 924 WP_001232557.1 putative lateral flagellar export/assembly protein LafU -
NL415_RS20490 (4078883) 4078883..4079938 + 1056 WP_001226183.1 DNA polymerase IV -
NL415_RS20495 (4079990) 4079990..4080283 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL415_RS20500 (4080286) 4080286..4080684 + 399 WP_001263484.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL415_RS20505 (4080694) 4080694..4081146 + 453 WP_001059899.1 GNAT family N-acetyltransferase -
NL415_RS20510 (4081391) 4081391..4081597 + 207 Protein_3873 RtcB family protein -
NL415_RS20515 (4081593) 4081593..4081945 + 353 Protein_3874 peptide chain release factor H -
NL415_RS20520 (4082002) 4082002..4083459 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NL415_RS20525 (4083720) 4083720..4084178 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (4084774) 4084774..4084854 + 81 NuclAT_7 - -
- (4084774) 4084774..4084854 + 81 NuclAT_7 - -
- (4084774) 4084774..4084854 + 81 NuclAT_7 - -
- (4084774) 4084774..4084854 + 81 NuclAT_7 - -
NL415_RS20530 (4084270) 4084270..4085514 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4075405..4103964 28559
- inside Prophage - - 4066933..4103964 37031


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15404.81 Da        Isoelectric Point: 7.3840

>T269843 WP_001263484.1 NZ_CP117016:4080286-4080684 [Escherichia coli]
MRVFKTKLICLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT269843 WP_000554755.1 NZ_CP117016:4079990-4080283 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X0YXS1

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References