Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2308346..2309145 | Replicon | chromosome |
| Accession | NZ_CP117016 | ||
| Organism | Escherichia coli strain MLI121 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A7B2BI69 |
| Locus tag | NL415_RS12060 | Protein ID | WP_000347258.1 |
| Coordinates | 2308681..2309145 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A368IY36 |
| Locus tag | NL415_RS12055 | Protein ID | WP_001604880.1 |
| Coordinates | 2308346..2308681 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL415_RS12040 (2304131) | 2304131..2304901 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NL415_RS12045 (2304917) | 2304917..2306251 | - | 1335 | WP_000599654.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NL415_RS12050 (2306626) | 2306626..2308197 | + | 1572 | WP_001273737.1 | galactarate dehydratase | - |
| NL415_RS12055 (2308346) | 2308346..2308681 | + | 336 | WP_001604880.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NL415_RS12060 (2308681) | 2308681..2309145 | + | 465 | WP_000347258.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NL415_RS12065 (2309200) | 2309200..2310009 | - | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| NL415_RS12070 (2310258) | 2310258..2311538 | + | 1281 | WP_000681943.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NL415_RS12075 (2311561) | 2311561..2312034 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NL415_RS12080 (2312045) | 2312045..2312824 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NL415_RS12085 (2312814) | 2312814..2313692 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NL415_RS12090 (2313710) | 2313710..2314144 | + | 435 | WP_000948829.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2299104..2309145 | 10041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.32 Da Isoelectric Point: 9.6924
>T269836 WP_000347258.1 NZ_CP117016:2308681-2309145 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEILKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNGWALYAHPCFQETYDALVAEVEILKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7B2BI69 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A368IY36 |