Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4126885..4127579 Replicon chromosome
Accession NZ_CP117013
Organism Escherichia coli strain MLI114

Toxin (Protein)


Gene name yafO Uniprot ID A0A1X0YXS1
Locus tag NL414_RS20680 Protein ID WP_001263484.1
Coordinates 4126885..4127283 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NL414_RS20685 Protein ID WP_000554755.1
Coordinates 4127286..4127579 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4122715) 4122715..4122795 - 81 NuclAT_7 - -
- (4122715) 4122715..4122795 - 81 NuclAT_7 - -
- (4122715) 4122715..4122795 - 81 NuclAT_7 - -
- (4122715) 4122715..4122795 - 81 NuclAT_7 - -
NL414_RS20650 (4122055) 4122055..4123299 - 1245 WP_000189541.1 esterase FrsA -
NL414_RS20655 (4123391) 4123391..4123849 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NL414_RS20660 (4124110) 4124110..4125567 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NL414_RS20665 (4125624) 4125624..4125976 - 353 Protein_3948 peptide chain release factor H -
NL414_RS20670 (4125972) 4125972..4126178 - 207 Protein_3949 RtcB family protein -
NL414_RS20675 (4126423) 4126423..4126875 - 453 WP_001059899.1 GNAT family N-acetyltransferase -
NL414_RS20680 (4126885) 4126885..4127283 - 399 WP_001263484.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL414_RS20685 (4127286) 4127286..4127579 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL414_RS20690 (4127631) 4127631..4128686 - 1056 WP_001226183.1 DNA polymerase IV -
NL414_RS20695 (4128757) 4128757..4129680 - 924 WP_001232557.1 putative lateral flagellar export/assembly protein LafU -
NL414_RS20700 (4129683) 4129683..4130546 - 864 WP_001169519.1 flagellar motor stator protein MotA -
NL414_RS20705 (4130559) 4130559..4131275 - 717 WP_000938719.1 FliA/WhiG family RNA polymerase sigma factor -
NL414_RS20710 (4131295) 4131295..4131450 - 156 Protein_3957 flagellar basal body protein FliL -
NL414_RS20720 (4132221) 4132221..4132487 - 267 Protein_3959 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15404.81 Da        Isoelectric Point: 7.3840

>T269821 WP_001263484.1 NZ_CP117013:c4127283-4126885 [Escherichia coli]
MRVFKTKLICLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT269821 WP_000554755.1 NZ_CP117013:c4127579-4127286 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X0YXS1

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References