Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 628325..629124 | Replicon | chromosome |
| Accession | NZ_CP117013 | ||
| Organism | Escherichia coli strain MLI114 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A7B2BI69 |
| Locus tag | NL414_RS03475 | Protein ID | WP_000347258.1 |
| Coordinates | 628325..628789 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A368IY36 |
| Locus tag | NL414_RS03480 | Protein ID | WP_001604880.1 |
| Coordinates | 628789..629124 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL414_RS03445 (623326) | 623326..623760 | - | 435 | WP_000948829.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NL414_RS03450 (623778) | 623778..624656 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NL414_RS03455 (624646) | 624646..625425 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NL414_RS03460 (625436) | 625436..625909 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NL414_RS03465 (625932) | 625932..627212 | - | 1281 | WP_000681943.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NL414_RS03470 (627461) | 627461..628270 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| NL414_RS03475 (628325) | 628325..628789 | - | 465 | WP_000347258.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NL414_RS03480 (628789) | 628789..629124 | - | 336 | WP_001604880.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NL414_RS03485 (629273) | 629273..630844 | - | 1572 | WP_001273737.1 | galactarate dehydratase | - |
| NL414_RS03490 (631219) | 631219..632553 | + | 1335 | WP_000599654.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NL414_RS03495 (632569) | 632569..633339 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.32 Da Isoelectric Point: 9.6924
>T269809 WP_000347258.1 NZ_CP117013:c628789-628325 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEILKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNGWALYAHPCFQETYDALVAEVEILKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7B2BI69 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A368IY36 |