Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 35263..35527 Replicon plasmid p80_MLI114
Accession NZ_CP117011
Organism Escherichia coli strain MLI114

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NL414_RS00210 Protein ID WP_001387489.1
Coordinates 35375..35527 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 35263..35323 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NL414_RS00195 (31366) 31366..32436 - 1071 WP_031942445.1 IncI1-type conjugal transfer protein TrbB -
NL414_RS00200 (32455) 32455..33663 - 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
NL414_RS00205 (33969) 33969..35054 - 1086 WP_074446708.1 protein finQ -
- (35263) 35263..35323 - 61 NuclAT_0 - Antitoxin
- (35263) 35263..35323 - 61 NuclAT_0 - Antitoxin
- (35263) 35263..35323 - 61 NuclAT_0 - Antitoxin
- (35263) 35263..35323 - 61 NuclAT_0 - Antitoxin
NL414_RS00210 (35375) 35375..35527 + 153 WP_001387489.1 Hok/Gef family protein Toxin
NL414_RS00215 (35599) 35599..35850 - 252 WP_001291964.1 hypothetical protein -
NL414_RS00220 (36351) 36351..36446 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
NL414_RS00225 (36511) 36511..36687 - 177 WP_001054897.1 hypothetical protein -
NL414_RS00230 (37079) 37079..37288 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
NL414_RS00235 (37360) 37360..38022 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
NL414_RS00240 (38093) 38093..40261 - 2169 WP_023518847.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..80847 80847


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T269804 WP_001387489.1 NZ_CP117011:35375-35527 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT269804 NZ_CP117011:c35323-35263 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References