Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 35263..35527 | Replicon | plasmid p80_MLI114 |
Accession | NZ_CP117011 | ||
Organism | Escherichia coli strain MLI114 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | NL414_RS00210 | Protein ID | WP_001387489.1 |
Coordinates | 35375..35527 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 35263..35323 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL414_RS00195 (31366) | 31366..32436 | - | 1071 | WP_031942445.1 | IncI1-type conjugal transfer protein TrbB | - |
NL414_RS00200 (32455) | 32455..33663 | - | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
NL414_RS00205 (33969) | 33969..35054 | - | 1086 | WP_074446708.1 | protein finQ | - |
- (35263) | 35263..35323 | - | 61 | NuclAT_0 | - | Antitoxin |
- (35263) | 35263..35323 | - | 61 | NuclAT_0 | - | Antitoxin |
- (35263) | 35263..35323 | - | 61 | NuclAT_0 | - | Antitoxin |
- (35263) | 35263..35323 | - | 61 | NuclAT_0 | - | Antitoxin |
NL414_RS00210 (35375) | 35375..35527 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
NL414_RS00215 (35599) | 35599..35850 | - | 252 | WP_001291964.1 | hypothetical protein | - |
NL414_RS00220 (36351) | 36351..36446 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
NL414_RS00225 (36511) | 36511..36687 | - | 177 | WP_001054897.1 | hypothetical protein | - |
NL414_RS00230 (37079) | 37079..37288 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
NL414_RS00235 (37360) | 37360..38022 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
NL414_RS00240 (38093) | 38093..40261 | - | 2169 | WP_023518847.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..80847 | 80847 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T269804 WP_001387489.1 NZ_CP117011:35375-35527 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT269804 NZ_CP117011:c35323-35263 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|