Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3634834..3635528 | Replicon | chromosome |
Accession | NZ_CP117010 | ||
Organism | Escherichia coli strain MLI110 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | NL413_RS18330 | Protein ID | WP_001263493.1 |
Coordinates | 3634834..3635232 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | NL413_RS18335 | Protein ID | WP_000554757.1 |
Coordinates | 3635235..3635528 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3630494) | 3630494..3630574 | - | 81 | NuclAT_11 | - | - |
- (3630494) | 3630494..3630574 | - | 81 | NuclAT_11 | - | - |
- (3630494) | 3630494..3630574 | - | 81 | NuclAT_11 | - | - |
- (3630494) | 3630494..3630574 | - | 81 | NuclAT_11 | - | - |
NL413_RS18300 (3629834) | 3629834..3631078 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
NL413_RS18305 (3631170) | 3631170..3631628 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
NL413_RS18310 (3631889) | 3631889..3633346 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
NL413_RS18315 (3633403) | 3633403..3633924 | - | 522 | Protein_3450 | peptide chain release factor H | - |
NL413_RS18320 (3633923) | 3633923..3634126 | - | 204 | Protein_3451 | RtcB family protein | - |
NL413_RS18325 (3634372) | 3634372..3634824 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
NL413_RS18330 (3634834) | 3634834..3635232 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NL413_RS18335 (3635235) | 3635235..3635528 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NL413_RS18340 (3635580) | 3635580..3636635 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NL413_RS18345 (3636706) | 3636706..3637491 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
NL413_RS18350 (3637463) | 3637463..3639175 | + | 1713 | Protein_3457 | flagellar biosynthesis protein FlhA | - |
NL413_RS18355 (3639399) | 3639399..3639896 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T269802 WP_001263493.1 NZ_CP117010:c3635232-3634834 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|