Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 707450..708143 | Replicon | chromosome |
Accession | NZ_CP117010 | ||
Organism | Escherichia coli strain MLI110 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NL413_RS04095 | Protein ID | WP_000415584.1 |
Coordinates | 707450..707746 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NL413_RS04100 | Protein ID | WP_000650107.1 |
Coordinates | 707748..708143 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL413_RS04060 (702538) | 702538..702852 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
NL413_RS04065 (702883) | 702883..703464 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NL413_RS04070 (703783) | 703783..704115 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
NL413_RS04075 (704161) | 704161..705510 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
NL413_RS04080 (705507) | 705507..706166 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
NL413_RS04085 (706318) | 706318..706710 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NL413_RS04090 (706763) | 706763..707245 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
NL413_RS04095 (707450) | 707450..707746 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NL413_RS04100 (707748) | 707748..708143 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NL413_RS04105 (708276) | 708276..709883 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
NL413_RS04110 (710021) | 710021..712279 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T269789 WP_000415584.1 NZ_CP117010:707450-707746 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT269789 WP_000650107.1 NZ_CP117010:707748-708143 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|