Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5000224..5000826 | Replicon | chromosome |
| Accession | NZ_CP117008 | ||
| Organism | Escherichia coli strain MLI109 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NL412_RS25155 | Protein ID | WP_000897305.1 |
| Coordinates | 5000515..5000826 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NL412_RS25150 | Protein ID | WP_000356395.1 |
| Coordinates | 5000224..5000514 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL412_RS25115 (4995848) | 4995848..4996750 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NL412_RS25120 (4996747) | 4996747..4997382 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NL412_RS25125 (4997379) | 4997379..4998308 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| NL412_RS25130 (4998490) | 4998490..4998732 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| NL412_RS25135 (4998951) | 4998951..4999169 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NL412_RS25140 (4999588) | 4999588..4999866 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| NL412_RS25145 (4999918) | 4999918..5000139 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| NL412_RS25150 (5000224) | 5000224..5000514 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| NL412_RS25155 (5000515) | 5000515..5000826 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NL412_RS25160 (5001055) | 5001055..5001963 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| NL412_RS25165 (5002131) | 5002131..5003045 | - | 915 | WP_109553727.1 | transposase | - |
| NL412_RS25170 (5003058) | 5003058..5003945 | - | 888 | Protein_4753 | hypothetical protein | - |
| NL412_RS25175 (5004361) | 5004361..5005302 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NL412_RS25180 (5005347) | 5005347..5005784 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T269786 WP_000897305.1 NZ_CP117008:c5000826-5000515 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|