Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4081389..4082083 Replicon chromosome
Accession NZ_CP117008
Organism Escherichia coli strain MLI109

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag NL412_RS20800 Protein ID WP_001263491.1
Coordinates 4081389..4081787 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag NL412_RS20805 Protein ID WP_000554755.1
Coordinates 4081790..4082083 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4077218) 4077218..4077298 - 81 NuclAT_9 - -
- (4077218) 4077218..4077298 - 81 NuclAT_9 - -
- (4077218) 4077218..4077298 - 81 NuclAT_9 - -
- (4077218) 4077218..4077298 - 81 NuclAT_9 - -
NL412_RS20770 (4076558) 4076558..4077802 - 1245 WP_000189541.1 esterase FrsA -
NL412_RS20775 (4077894) 4077894..4078352 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
NL412_RS20780 (4078613) 4078613..4080070 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
NL412_RS20785 (4080127) 4080127..4080479 - 353 Protein_3903 peptide chain release factor H -
NL412_RS20790 (4080475) 4080475..4080681 - 207 Protein_3904 RtcB family protein -
NL412_RS20795 (4080927) 4080927..4081379 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
NL412_RS20800 (4081389) 4081389..4081787 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
NL412_RS20805 (4081790) 4081790..4082083 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
NL412_RS20810 (4082135) 4082135..4083190 - 1056 WP_001550655.1 DNA polymerase IV -
NL412_RS20815 (4083261) 4083261..4084046 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
NL412_RS20820 (4084018) 4084018..4085730 + 1713 Protein_3910 flagellar biosynthesis protein FlhA -
NL412_RS20825 (4085835) 4085835..4086113 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
NL412_RS20830 (4086106) 4086106..4086462 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4071325..4082083 10758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T269782 WP_001263491.1 NZ_CP117008:c4081787-4081389 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT269782 WP_000554755.1 NZ_CP117008:c4082083-4081790 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References