Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4081389..4082083 | Replicon | chromosome |
| Accession | NZ_CP117008 | ||
| Organism | Escherichia coli strain MLI109 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | NL412_RS20800 | Protein ID | WP_001263491.1 |
| Coordinates | 4081389..4081787 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | NL412_RS20805 | Protein ID | WP_000554755.1 |
| Coordinates | 4081790..4082083 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (4077218) | 4077218..4077298 | - | 81 | NuclAT_9 | - | - |
| - (4077218) | 4077218..4077298 | - | 81 | NuclAT_9 | - | - |
| - (4077218) | 4077218..4077298 | - | 81 | NuclAT_9 | - | - |
| - (4077218) | 4077218..4077298 | - | 81 | NuclAT_9 | - | - |
| NL412_RS20770 (4076558) | 4076558..4077802 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| NL412_RS20775 (4077894) | 4077894..4078352 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| NL412_RS20780 (4078613) | 4078613..4080070 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
| NL412_RS20785 (4080127) | 4080127..4080479 | - | 353 | Protein_3903 | peptide chain release factor H | - |
| NL412_RS20790 (4080475) | 4080475..4080681 | - | 207 | Protein_3904 | RtcB family protein | - |
| NL412_RS20795 (4080927) | 4080927..4081379 | - | 453 | WP_019842500.1 | GNAT family N-acetyltransferase | - |
| NL412_RS20800 (4081389) | 4081389..4081787 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NL412_RS20805 (4081790) | 4081790..4082083 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NL412_RS20810 (4082135) | 4082135..4083190 | - | 1056 | WP_001550655.1 | DNA polymerase IV | - |
| NL412_RS20815 (4083261) | 4083261..4084046 | - | 786 | WP_019842510.1 | putative lateral flagellar export/assembly protein LafU | - |
| NL412_RS20820 (4084018) | 4084018..4085730 | + | 1713 | Protein_3910 | flagellar biosynthesis protein FlhA | - |
| NL412_RS20825 (4085835) | 4085835..4086113 | + | 279 | WP_000598760.1 | type II toxin-antitoxin system HicA family toxin | - |
| NL412_RS20830 (4086106) | 4086106..4086462 | + | 357 | WP_001030484.1 | type II toxin-antitoxin system HicB family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4071325..4082083 | 10758 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T269782 WP_001263491.1 NZ_CP117008:c4081787-4081389 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |