Detailed information of TA system TA269760

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 101744..102170
• Replicon: plasmid p140_MLI109
• Accession: NZ_CP117007
• Organism: Escherichia coli strain MLI109

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NL412_RS00600
• Protein ID: WP_001372321.1
• Coordinates: 102045..102170 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	101744..101968 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NL412_RS00565 (97181)	97181..98392	+	1212	WP_001390768.1	dispersin export-associated protein AatD	-
NL412_RS00570 (99022)	99022..99662	+	641	WP_248785200.1	IS1 family transposase	-
NL412_RS00575 (99654)	99654..100145	-	492	WP_228340195.1	hypothetical protein	-
NL412_RS00580 (100225)	100225..100527	+	303	Protein_115	hypothetical protein	-
NL412_RS00585 (100582)	100582..101016	+	435	WP_000845949.1	conjugation system SOS inhibitor PsiB	-
NL412_RS00590 (101013)	101013..101775	+	763	Protein_117	plasmid SOS inhibition protein A	-
- (101744)	101744..101968	+	225	NuclAT_0	-	Antitoxin
- (101744)	101744..101968	+	225	NuclAT_0	-	Antitoxin
- (101744)	101744..101968	+	225	NuclAT_0	-	Antitoxin
- (101744)	101744..101968	+	225	NuclAT_0	-	Antitoxin
NL412_RS00595 (101954)	101954..102103	+	150	Protein_118	plasmid maintenance protein Mok	-
NL412_RS00600 (102045)	102045..102170	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NL412_RS00605 (102473)	102473..102722	-	250	Protein_120	hypothetical protein	-
NL412_RS00610 (103023)	103023..103310	+	288	WP_000107526.1	hypothetical protein	-
NL412_RS00615 (103429)	103429..104250	+	822	WP_001234469.1	DUF932 domain-containing protein	-
NL412_RS00620 (104545)	104545..105147	-	603	WP_077786836.1	transglycosylase SLT domain-containing protein	-
NL412_RS00625 (105478)	105478..105861	+	384	WP_023063829.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NL412_RS00630 (106055)	106055..106747	+	693	WP_001403354.1	PAS domain-containing protein	-
NL412_RS00635 (106835)	106835..107062	+	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	agg3D / agg3C / agg3B / aap/aspU / pic	1..140278	140278
	-	flank	IS/Tn	-	-	99216..99662	446

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T269760 WP_001372321.1 NZ_CP117007:102045-102170 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT269760 NZ_CP117007:101744-101968 [Escherichia coli]
TCACACAGATTATCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin